(data stored in ACNUC10043 zone)

EMBL: AP011532.PE38

AP011532.PE38        Location/Qualifiers
FT   CDS_pept        complement(28331..28759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0038"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60110"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUI8"
FT                   /protein_id="BAI60110.1"
FT                   /translation="MFGSPLGSPFGSLFGHSPLTGYGLGNYPYYSMPSTTSYSIFDDDV
FT                   FSGFGDAFSGSLFGQKDYGTPPEEAIKDTLVGSNLTYNGGFMSIPLQYRLDETDIGEIA
FT                   GTQYDGEDAWKVRVGQAGVYWDVILDETGTEVLKASQV"
     atgttcggct cgccgctcgg cagccctttc gggagcttgt tcggacacag cccgctcact        60
     ggctacggcc tcgggaacta cccgtattat agcatgccct cgacgacgtc gtactccatc       120
     ttcgacgacg acgtgttctc gggcttcggc gacgctttca gcggcagcct gttcgggcaa       180
     aaggactacg gcacgccccc ggaggaggcc atcaaggata ctctcgtagg ctcgaacctc       240
     acgtataacg gcggcttcat gagcatcccg ctccagtaca ggctcgacga gaccgacatc       300
     ggcgagatcg ccgggacaca gtatgacggc gaggacgcat ggaaggtgcg cgtgggccag       360
     gcgggcgtat actgggacgt catcctggac gagacgggca ccgaggtcct gaaggccagc       420
     caggtgtga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page