(data stored in ACNUC10043 zone)

EMBL: AP011532.PE380

AP011532.PE380       Location/Qualifiers
FT   CDS_pept        384443..385195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0380"
FT                   /product="putative cobalt ABC transporter ATP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60452"
FT                   /db_xref="GOA:D1YVI0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVI0"
FT                   /protein_id="BAI60452.1"
FT                   /translation="MISLRDVSFSYGCLSALDHISLQVEKGEHMALIGPNASGKTTLAM
FT                   VMNALLTPDRGECLVEGIDTRDDPMFARRTVGMVFQDPESQTVARRVWDDVAFGPMNLG
FT                   LPDGEVEKRVRESLDHVGLGAFSRREVSCLSGGQKQLLAVAGILAMKPSYIVFDEPTAL
FT                   LDGPGCRMVNKAVAGLKKNGIGIITITHDMEEALTADRIVALDTGRIVADMPPASLFSD
FT                   EALMARIGIKPPYTFNLAVPREVVRECR"
     ttgatatcct tacgtgacgt atccttttct tatggctgcc tcagtgcgct ggaccatatc        60
     tcacttcagg tggagaaagg cgagcacatg gcccttatcg ggccgaacgc ctcgggcaag       120
     accacgctgg ccatggtcat gaacgccctg ctcacgccgg acagaggcga gtgcctggtc       180
     gaaggcatcg ataccaggga cgaccctatg ttcgcccgcc gcaccgtcgg catggtcttc       240
     caggacccgg agagccagac cgtggccagg cgcgtatggg atgacgtcgc cttcgggccg       300
     atgaacctgg gcctgcccga cggcgaggtt gaaaagaggg tacgcgagtc cctcgatcat       360
     gtcgggcttg gcgcattctc ccggcgtgag gtctcgtgcc tttccggagg ccagaagcag       420
     ctccttgccg tcgccggaat actggccatg aagccttcct atatcgtgtt cgacgagccc       480
     acggcgctcc tcgacgggcc tggttgccgc atggtcaata aagcagttgc gggcctcaag       540
     aaaaacggca taggcattat cacgatcacg cacgacatgg aagaagcgct gaccgctgac       600
     cggatagttg cactggatac ggggcgcatc gtggccgata tgcctcctgc cagccttttt       660
     tccgatgagg cccttatggc tcgcatcggt atcaagccgc cttatacttt taatctggcc       720
     gtgccccggg aggtggtccg ggaatgccgt tag                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page