(data stored in ACNUC10043 zone)

EMBL: AP011532.PE385

AP011532.PE385       Location/Qualifiers
FT   CDS_pept        391279..391590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Rieske [2Fe-2S] regiondomain
FT                   (IPR005806)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0385"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60457"
FT                   /db_xref="GOA:D1YVI5"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVI5"
FT                   /protein_id="BAI60457.1"
FT                   /translation="MAEFTKLVRKNDVTPGKMKSVYVSAVSANITVANIDGKYYAFKDE
FT                   CPHMGVRLSNGSIENGIITCPEHSSKFDVTTGKPLSTQNDPLVTYEVKIEGDDVLVKV"
     atggctgagt tcacgaagct tgtcaggaaa aacgacgtta cgccggggaa gatgaagtcc        60
     gtctatgtat cggccgtaag cgccaacatc accgtcgcga acatcgatgg caagtattat       120
     gcgttcaagg acgaatgccc ccacatggga gtccggctct cgaacggcag tatcgagaac       180
     ggcatcatca cctgccccga gcacagctcg aagttcgacg tcacaaccgg gaagcccttg       240
     tcgacgcaga acgacccgct cgtgacctac gaggtcaaga tcgagggcga cgacgtgctc       300
     gtaaaagtat ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page