(data stored in ACNUC10043 zone)

EMBL: AP011532.PE389

AP011532.PE389       Location/Qualifiers
FT   CDS_pept        complement(393308..394474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0389"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60461"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVI9"
FT                   /protein_id="BAI60461.1"
FT                   /translation="MKPVSVEDVNRLVLRKQHLSDDSRAERLVEMVWDIGGLHATSAIG
FT                   PYISAFLRCKDFRREDLDRELYVNKSLGQLRCMRFTMYIQPTGAFAMYHSAMKRTFETG
FT                   YLSRLKRVAMPEKEYERLERSILALLRDGGKTAAEIKKALGVDTSLFQVLNAMCDTGLL
FT                   AKGMPKGSWKSNLHTYHLFGDYYPDVDLEMEEKLATASLALHYLKAFGPATEADIAWWT
FT                   GLRRSDIREAIESLEARTDRIDVSGLGNDMIVDYVDIRSIQGARAPKKPAVRLLPSLDP
FT                   YLMGYKDRDRYLDKKHYGCVYDRSGNATTCIMVDGRIAGVWDIDEKAIGVYLFEEAPES
FT                   VLREIRRQAEEMSVFLLGKPLPIKECSSMVPLSDRPPGAVMTPLKGQI"
     atgaagcccg tcagtgtcga ggacgtgaac cggctcgtcc tgcgcaagca gcatttatcg        60
     gatgattcca gggccgaacg ccttgtggag atggtatggg atatcggcgg cctccacgcg       120
     accagcgcca tcgggccgta catatccgcg ttcttgaggt gtaaggattt ccgcagggaa       180
     gacctggacc gggagcttta cgtcaataaa agccttgggc agctgcgctg tatgcggttc       240
     acgatgtaca tccagccgac gggcgcgttc gcgatgtacc attcggcgat gaagcgcacc       300
     tttgagacgg gctacctgag ccggctgaag cgcgtcgcca tgcccgaaaa agagtacgag       360
     cgcctggaga gatccatcct cgcgctgctc cgggatgggg gtaagacggc ggccgaaata       420
     aaaaaagctc tgggggtcga cacgagcctg ttccaggtcc tgaacgccat gtgcgatacc       480
     gggctgctgg caaagggcat gccgaagggg agctggaaga gcaacctgca tacataccac       540
     ctgttcggcg actattatcc cgatgtcgac ctggagatgg aagaaaaatt ggcgaccgct       600
     tcgctggccc ttcactacct gaaggccttc ggcccggcaa cagaggcgga catcgcgtgg       660
     tggacaggcc tgagaaggtc ggatatcagg gaagctattg agagcctgga ggcgcggacg       720
     gatcgcatcg acgtttcggg gctcgggaat gacatgatcg tcgattacgt cgacataagg       780
     tcgatacaag gcgccagggc cccgaagaag cccgcagtgc gcctgctgcc gtcgctcgac       840
     ccatacctga tgggctacaa ggacagggac cggtatctgg acaagaagca ttacggctgc       900
     gtatacgacc gctcgggcaa cgcaacgaca tgtataatgg tcgacggcag gatcgccggg       960
     gtctgggaca tcgatgaaaa ggcgatcgga gtgtatcttt tcgaagaagc cccggagagc      1020
     gttcttcgag agataaggcg gcaggcggag gagatgagcg tcttcctgct tggaaagcct      1080
     ttacccatca aagaatgtag ctcgatggtg ccgctatctg acaggccgcc aggagccgtc      1140
     atgacgccgc tcaaaggtca gatttaa                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page