(data stored in ACNUC10043 zone)

EMBL: AP011532.PE392

AP011532.PE392       Location/Qualifiers
FT   CDS_pept        complement(395115..395504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0392"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60464"
FT                   /db_xref="GOA:D1YVJ2"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVJ2"
FT                   /protein_id="BAI60464.1"
FT                   /translation="MNTSFYKYVLWLSSAVVFVSLGWMFFLNRIDLIALVLFAVGIVLV
FT                   VGTLSRYNQCNSPEDERMRKVAAFSMMNSWVSGVTLLAMLLVMQYLNWWRYVLSGLQVI
FT                   CLTIAVLLLTYYGWYIYYSSRGDIA"
     atgaatacct ccttctacaa gtatgtactc tggctgagct cggccgtcgt gttcgtatcg        60
     ctgggctgga tgttcttcct gaaccgcatc gacctcatcg cgctggtatt attcgccgtc       120
     ggcattgtcc tggtcgttgg cacgctctcg cgttataacc agtgcaatag ccctgaggat       180
     gagcgcatgc ggaaagtggc cgccttctcc atgatgaact cctgggtgtc gggcgtcacg       240
     ctcctggcca tgctgctggt catgcagtac ttaaactggt ggcgctatgt gctgagcggc       300
     cttcaggtca tatgcctgac catcgcagtg ctgctgttga cctattacgg gtggtatatc       360
     tactactcgt ccagagggga catagcatag                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page