(data stored in ACNUC10043 zone)

EMBL: AP011532.PE397

AP011532.PE397       Location/Qualifiers
FT   CDS_pept        400585..400989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Helix-turn-helix type 3 domain
FT                   (IPR001387)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60469"
FT                   /db_xref="GOA:D1YVJ7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVJ7"
FT                   /protein_id="BAI60469.1"
FT                   /translation="MYAPEWMFDNAKIIAGEIVNAQDRGTIIQIHRGKMDLTQEELSRI
FT                   MRLRRETISRIEHGKVTPTLSFIHTFSGIATLMEAVRSYRSMNRAVEYLYFIRIGAELG
FT                   VPRDYVVSIVDTAVKNYDRKRKKAIRYLER"
     atgtatgcgc cggaatggat gttcgataat gccaagatca tcgcgggcga gatagtcaac        60
     gcgcaggaca ggggcacgat catccagata caccggggaa agatggacct cacacaggag       120
     gagctgagcc ggatcatgcg gctgcggaga gagacgatct cccgcataga gcacggcaag       180
     gtcacgccca cgctctcgtt catccacacc ttctcgggca ttgcgacgct gatggaagcc       240
     gttagatcgt acaggtcgat gaaccgggcc gtcgaatacc tctattttat ccgcatcggg       300
     gccgagctcg gggtgccccg ggactatgtc gtatccatcg tggatacggc cgtcaagaac       360
     tatgacagga aacgcaagaa agcgatacga tatctggaga gatga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page