(data stored in ACNUC10043 zone)

EMBL: AP011532.PE403

AP011532.PE403       Location/Qualifiers
FT   CDS_pept        407282..408781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0403"
FT                   /product="peptidase S8 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0403"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60475"
FT                   /db_xref="GOA:D1YVK3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVK3"
FT                   /protein_id="BAI60475.1"
FT                   /translation="MLLASALLVNASIPLTKPSTDLSSGTYIVVFNDSQGMAGALSDQV
FT                   SAFAVENNATVKYRYDLINGMAIDVPTADAAAKLSTLKGVKYVEKNIVFHVTLDTGRSI
FT                   VGAPQVWDLGYTGKGMKVAVVDTGIDGTHPDLKGRIVDFKDYVSGKTTAYDDFGHGTHC
FT                   AGIIGGSGAASNGKYKGVAPEVQFIGVKVLGKDGSGSLDAIIAGLNYAAKSDAKVISMS
FT                   LGSDEHSQSMDDAVNNAVKAGKVVVCAAGNSGPGSKTIGCPADTPSALTVGATDKSDAI
FT                   ASFSSRGPNRDGTVKPDVSAPGKDIISCRATGTNDQKAIDTYYLSMSGTSMATPMVSGS
FT                   VILLLQKKPDLTPAEVKDIMEKTAKQLGSGVPNNNFGYGRISIVNAINYLDGKYTPPTT
FT                   PSPTPTPSPSPSPSPSPNPGNPGNPGYPGYPYPGYPYPGYPYPGQPTPTPTPTPTPDPG
FT                   NPGYPGYPYPGYPYPGYPYPSYPGYPYPGYPYPGYYGISDE"
     gtgctactgg ccagcgcatt gttggtaaat gcgagcatac cgctgactaa gccctccacg        60
     gatctcagca gcggcaccta tattgtcgtt tttaatgaca gccagggcat ggctggcgcg       120
     ctgagcgacc aggtctctgc cttcgccgtc gagaataacg cgacggtcaa atacaggtat       180
     gacctcatca acggcatggc catcgacgtc ccgaccgccg acgcggccgc gaagctgagc       240
     actctcaagg gcgtgaaata cgtcgagaag aacatcgtat tccacgtcac gctcgacacg       300
     ggcaggtcca tcgtcggcgc cccgcaggtc tgggacctcg ggtacaccgg caagggcatg       360
     aaggtcgccg tcgtcgacac cggcatcgac ggcacccatc ccgacctcaa gggcaggatc       420
     gtcgacttca aggactacgt ttcaggcaag accaccgcct acgatgactt cggccacggc       480
     acccactgcg ccggcatcat cggcggcagc ggcgccgcct cgaacggcaa gtacaagggc       540
     gttgcccccg aagtccagtt catcggcgtc aaggtgctcg gcaaggacgg ctccggaagc       600
     ctggacgcca tcatcgccgg cctgaactat gcggccaaga gcgacgctaa agtgatctcg       660
     atgtcgctcg gctcggacga gcactcgcag tccatggacg acgccgttaa caacgccgta       720
     aaagccggca aggtcgtcgt ctgcgcggca ggcaacagcg gccctggctc gaagaccatc       780
     ggctgccccg cggatacccc ctcggccctg acggtcggcg ccaccgacaa gagcgatgcc       840
     atcgcttcgt tcagctccag gggccccaac agggacggca ccgtcaagcc cgacgtcagc       900
     gcccctggca aggacatcat atcctgcagg gccacgggca ccaacgacca gaaggccatc       960
     gacacctact acctgtcgat gagcggcacc tccatggcca cccccatggt atcgggctcc      1020
     gtcattctgc tgctgcagaa gaagccggac ctgacgcccg ccgaggtcaa ggacatcatg      1080
     gagaagaccg cgaagcagct cggctccggc gtcccgaaca ataacttcgg ctacggcagg      1140
     atcagcatcg tcaacgcgat caactacctg gacggcaagt atacgcctcc gaccaccccg      1200
     tcgccgacgc caaccccgag cccgagcccg tctccctccc cgtcgccgaa ccccggcaac      1260
     ccgggcaacc ccggctaccc tggctacccg taccctggat atccgtatcc tggctacccg      1320
     taccccggac agccgacccc gacgcctacg ccgacgccca cgcctgaccc gggcaacccc      1380
     ggctaccctg gctacccgta ccctggatat ccgtatcctg gctacccgta cccgagctac      1440
     cccggctacc cgtaccctgg ttacccttac ccgggctact acggcattag cgacgaataa      1500
//

If you have problems or comments...

PBIL Back to PBIL home page