(data stored in ACNUC10043 zone)

EMBL: AP011532.PE406

AP011532.PE406       Location/Qualifiers
FT   CDS_pept        409618..410283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0406"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60478"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVK6"
FT                   /protein_id="BAI60478.1"
FT                   /translation="MRLRVIAILALLLASLTVLSAAQTPDYGGKAKVVLKLTKMPDMPA
FT                   MPQNEASGSTATFGLATADLATPEVPQGTMAQGEVLYSGDPAVKAGQAYTLYINYDSGH
FT                   APAGFLAGLIDNLKSGAVIGVNDYALSGNIITVTVGPSDDWSKKIFILDLSGTDGSKNP
FT                   FLIDLSGFRQFSAFPAFNYTTELKPMLNMSIPGMGLNTSFPGFQQTSGLFSMFSHFFG"
     atgaggttga gggtaattgc tatactggcg ctgcttttag cgtcgctgac cgtgctgagc        60
     gccgcacaga cgccagacta cgggggaaag gcgaaagtag tcctgaagct gacgaagatg       120
     ccggacatgc cggcgatgcc tcagaacgag gcctcgggct ccacggcgac ttttggcctg       180
     gctacggccg atctggccac tccggaggtg ccgcagggca ccatggccca gggcgaggtg       240
     ctctactcgg gcgatcctgc ggtaaaggca gggcaggctt acacgcttta cattaactac       300
     gactccggcc atgcgcctgc cggattcctg gcggggctca tcgacaacct gaagtcgggc       360
     gccgtcatag gcgttaatga ctatgccctg agcgggaaca ttattaccgt cactgtcggc       420
     ccttctgacg actggagtaa aaagatattc atactggacc tgtcgggcac ggacgggagc       480
     aagaacccct tcctgatcga cctgagcggg ttccggcagt tcagcgcgtt cccggccttc       540
     aactacacca cggagttaaa gccgatgtta aatatgtcca tccctggtat gggcttgaat       600
     accagtttcc cgggattcca gcagacgtcc ggccttttca gcatgttcag ccacttcttt       660
     ggctga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page