(data stored in ACNUC10043 zone)

EMBL: AP011532.PE411

AP011532.PE411       Location/Qualifiers
FT   CDS_pept        complement(413820..414569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0411"
FT                   /product="ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0411"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60483"
FT                   /db_xref="GOA:D1YVL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVL1"
FT                   /protein_id="BAI60483.1"
FT                   /translation="MLSIEHLTVEVDDKRILNDVNMFIGEGETHALFGPNGSGKSSLLF
FT                   TMAGVPKYKVKSGKITFKGKDITDAPMDERAKMGIGILFQHPPVLRGVKLNDMVKVSME
FT                   QLNHKKVSDQDVAELARKLNLENFLSRDVNLGFSGGEIKRSELLQLLAQRPDLVLLDEP
FT                   DSGVDLVNIGLVGNTINELLQKDKKTVHRSKSGLIITHFGNILDYVKADKAYVMMKGTV
FT                   LCQGNPVELLDDIRHRGYSECLSCLNR"
     atgctaagca tcgaacactt aaccgtcgag gtcgacgata agcgcatcct caacgacgtg        60
     aacatgttca tcggggaagg ggagacgcac gctctcttcg gccccaacgg gtcggggaag       120
     agctccctgc tgttcacgat ggccggggtg cccaagtaca aggtaaagtc cggcaagatc       180
     accttcaagg gcaaggacat caccgatgcc cccatggacg agcgcgcgaa gatgggcatc       240
     ggcatcctgt tccagcaccc gcccgtgctt cggggagtaa agctgaacga catggtcaag       300
     gtcagcatgg agcagcttaa ccacaagaag gtgtccgacc aggatgtcgc cgagctcgcc       360
     aggaagctca acctcgagaa cttcctgtcc cgagacgtaa atttaggatt ttctggaggc       420
     gagatcaagc ggtcggaact gctgcagctt cttgctcaga ggccggacct tgtgctgctg       480
     gacgagcccg acagcggcgt cgatctggtc aatatcgggc tggtgggcaa caccatcaac       540
     gaattactac agaaggataa gaagacggta catcgttcca agtccggctt gattatcacc       600
     cacttcggta acattttaga ctacgtcaag gccgataagg cctacgtcat gatgaagggc       660
     accgtgctct gccagggtaa cccggtcgag ctattagatg atatcaggca ccgcggctac       720
     tcggagtgtt tatcatgctt gaaccggtaa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page