(data stored in ACNUC10043 zone)

EMBL: AP011532.PE414

AP011532.PE414       Location/Qualifiers
FT   CDS_pept        complement(416975..417442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0414"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60486"
FT                   /db_xref="GOA:D1YVL4"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVL4"
FT                   /protein_id="BAI60486.1"
FT                   /translation="MKTLIACYSFTGNTSKVAESLKEATGADFTRIEPVKDANYLMKCL
FT                   SALFKRRTPIKPCATDLKGYDAVIVCSPVWADSVPAAINQYIDELKGCEGKKFGIIVTY
FT                   GSTGQNRVSGQIMAALEKKKMTFIDSIWVTQDEARAGDYAEKVKQLAAELN"
     atgaagaccc tcatcgcctg ctattcattt accggtaata cctccaaggt ggccgagagc        60
     ctgaaggagg ccacaggtgc cgactttacc cgcatagagc ccgtcaagga cgctaactac       120
     ctgatgaaat gcctgagcgc actattcaag aggcggacgc ccatcaagcc ctgtgccacg       180
     gacctgaagg gttacgatgc ggtcatcgtg tgctcacccg tatgggcgga cagcgtcccc       240
     gccgccatca accagtacat cgacgagctg aagggctgcg agggcaagaa gttcggcatt       300
     atcgtcacgt acgggagcac gggccagaac cgggtctccg gccagatcat ggcggcgctc       360
     gaaaagaaaa agatgacgtt catagactcc atatgggtaa cccaggacga ggcccgggca       420
     ggcgactacg cggaaaaggt caaacagctt gccgccgagc ttaactaa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page