(data stored in ACNUC10043 zone)

EMBL: AP011532.PE418

AP011532.PE418       Location/Qualifiers
FT   CDS_pept        complement(419096..419449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0418"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60490"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVL8"
FT                   /protein_id="BAI60490.1"
FT                   /translation="MEQAAEAIPVQKPASVMTMQNLAALGLALAIDFTDAVPSELLFLI
FT                   GLPPVAMGIESGVSVVEAAYLSYLGVPVVKWLAMSGVDLLPIVDIIPWCTLAVLDRRFN
FT                   LKIPLVTKLFNYS"
     atggaacagg ccgccgaagc gataccagta cagaaacctg cgtccgtcat gacgatgcag        60
     aacctcgcgg cgctgggcct ggcgctggcc atcgacttta cggatgccgt gccgtcggag       120
     cttttattcc tgatcggcct cccgcccgtc gccatgggaa tagagtcggg cgtatcggtc       180
     gtcgaggcag cgtacctgtc gtacctcggc gtgccggtgg tcaagtggct tgccatgagc       240
     ggcgtcgacc tgttaccgat agtggacatc attccctggt gcacgctggc cgtgctcgac       300
     cggcggttca acctgaagat ccccctggtc actaagctat tcaactactc gtag             354
//

If you have problems or comments...

PBIL Back to PBIL home page