(data stored in ACNUC10043 zone)

EMBL: AP011532.PE421

AP011532.PE421       Location/Qualifiers
FT   CDS_pept        complement(422806..423195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60493"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVM1"
FT                   /protein_id="BAI60493.1"
FT                   /translation="MDVLLSIKPKYANKIIDGEKKFEFRKIKLDKRKIGHIYIYSTSPV
FT                   KKIIAKIAIGDIIEDSPERLWKRCEKHSGISKEEFFSYYAEKEVGFAITIKKVEPLDVP
FT                   IDPYVKIENFTPPQSYYYLKDGSLF"
     atggacgttt tactttcgat taaaccgaag tacgccaaca aaattatcga tggagaaaag        60
     aagtttgaat tccggaagat aaagctggat aagcgaaaaa tcggacatat atacatttac       120
     tcgacatcgc ctgtaaaaaa aatcatagct aagattgcta taggggacat catcgaagac       180
     tcgccagaac ggctttggaa acgatgcgaa aaacactctg ggatatcgaa agaagaattc       240
     tttagctatt atgcggaaaa agaagttggg tttgcgatta cgattaaaaa agttgagcca       300
     cttgacgtgc ctatcgatcc atatgtaaag attgaaaatt tcacgccgcc gcagtcctat       360
     tattatttaa aagatggtag tttattttaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page