(data stored in ACNUC10043 zone)

EMBL: AP011532.PE425

AP011532.PE425       Location/Qualifiers
FT   CDS_pept        426684..427196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0425"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0425"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60497"
FT                   /db_xref="GOA:D1YVM5"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVM5"
FT                   /protein_id="BAI60497.1"
FT                   /translation="MVQNGNDLKDRLPEKTLLVVFSYHHMNTEKVAKVFANVLDAQVKT
FT                   PRQVNPGELGDYDLIGFGSGIDSGRHYKELLDFADALPRVAGKKAFIFSTSAIVGADKV
FT                   WKDHSALREKLQAKGYVIVDEFACKGYNTNSFLKYIGGMNKGRPNAEDLKQAEEFALGL
FT                   KQKLKEM"
     atggtgcaga acgggaatga tctcaaggat cggctaccag aaaaaactct tctggtcgtc        60
     ttttcgtatc accacatgaa taccgagaaa gtcgccaaag tcttcgcgaa cgtgctcgat       120
     gcacaggtga aaacaccacg gcaggtaaat cctggagaac tcggtgacta tgatctcata       180
     ggctttggtt ctggcattga cagcggaagg cattataaag aattgctcga ttttgccgat       240
     gctctgcccc gggtcgccgg gaagaaagcg ttcatatttt ccacgagcgc tatcgtgggg       300
     gctgataaag tctggaaaga ccactcggcg ctcagggaaa agctacaggc gaaggggtac       360
     gtgatcgtcg acgagttcgc ctgcaagggg tacaatacga acagcttcct caagtacatc       420
     ggcgggatga acaaggggag gcccaacgcg gaagacctca agcaggcgga agagttcgcc       480
     ctgggcctga agcagaaact gaaagaaatg tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page