(data stored in ACNUC10043 zone)

EMBL: AP011532.PE427

AP011532.PE427       Location/Qualifiers
FT   CDS_pept        427833..428579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0427"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60499"
FT                   /db_xref="GOA:D1YVM7"
FT                   /db_xref="InterPro:IPR025495"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVM7"
FT                   /protein_id="BAI60499.1"
FT                   /translation="MKGIVMDTEIRAESPVKYAPRLLGAAFLFVILTSLAGGLLLKSAA
FT                   GSGSIADVLVNVSQNPTLFRIDILDGLLNSTGIVALAGLLYVVLRQQNKPLARIALGLW
FT                   LAEAIFYAIIQMGLLALIPLSAEFVAAGAPAGSFYLTLGDFLYNGVYAQGMTIHMWFYC
FT                   MGGLIWYYLFYRSNYIPRAISLFGLLAVILGLGSVVFQLLGYEVPILVSLPLLPFELAI
FT                   GAWLLFLGIREQATAVNPSRQPAVQG"
     ttgaagggaa tcgtcatgga tactgaaata cgggcggaga gccctgtaaa atacgccccc        60
     cggcttctgg gggcagcgtt tctgtttgtg atactaacca gcctggcagg cggtctcctg       120
     ctgaagtcgg cggccggctc gggtagcata gcggacgtgc tggtcaacgt ttcgcaaaat       180
     cccaccctgt tccgcatcga cattctggac gggttgctga atagcacggg gatcgtggca       240
     ctggcaggcc ttctttacgt ggtcttgagg caacagaaca agccgctggc gcgcatcgcc       300
     ctgggattgt ggctggcgga agcgatattc tatgccatta tccagatggg gcttctggca       360
     ctgatacccc tgagcgcgga gttcgtcgcc gcgggcgcgc ccgccggatc gttctatctg       420
     acgctgggcg atttcctgta caacggcgtg tatgcccagg gtatgaccat acacatgtgg       480
     ttctattgca tgggcggcct gatatggtat tacctgtttt accggtcgaa ctatatcccg       540
     cgtgccatat ccctcttcgg cctgctggcg gtaattttag gactgggaag cgtcgtattt       600
     caactactcg gctatgaggt cccgatcctg gtatccctgc cgctcctgcc attcgaatta       660
     gccatcgggg catggctcct gttcctaggc ataagggagc aggcgacggc cgtgaacccg       720
     tcccggcagc cggcagtaca gggatag                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page