(data stored in ACNUC10043 zone)

EMBL: AP011532.PE430

AP011532.PE430       Location/Qualifiers
FT   CDS_pept        complement(430609..431226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60502"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVN0"
FT                   /protein_id="BAI60502.1"
FT                   /translation="MVFTLIVFSSAMFAGMQAEKAEANANLTAYKTVPPNSWEPMGYNM
FT                   TGTAPYFITHTLNWSNTRIMGNLGIGDGSVRTLNDTSNRDVNYTDNNFMAADISMAPWD
FT                   PGRLTALNPLAGTTNATQAVVNETGNATNETVGNVTESSSINFNRPLSDPYHPILMGRP
FT                   VDDLLYEYPLATPINMYARLLGLRMPGGSCLNMGVKCLGYGY"
     atggttttta cattaatagt gttttcatcc gccatgtttg ccggcatgca ggcagagaag        60
     gccgaggcca atgccaacct tacggcatat aaaacagttc ctccgaacag ctgggagcca       120
     atgggatata atatgaccgg cacggcccca tattttatca cgcacacgct caactggagc       180
     aacacgagga tcatgggtaa ccttggcatc ggcgacggca gcgtgcgaac gctcaacgac       240
     accagtaacc gcgacgtaaa ttacacggat aataacttca tggccgccga catctccatg       300
     gcaccatggg atccgggccg gctaacggcc ttgaatccac tggccggtac tactaatgcc       360
     acacaggcag tagttaatga aactggcaat gctaccaacg agacggtggg caatgtcacg       420
     gagtctagca gtataaactt caataggccc ctcagcgacc catatcatcc gattctcatg       480
     gggaggcccg tggatgacct gttgtacgaa tatcccctgg ccacgcccat taacatgtat       540
     gccaggctgc tgggattgag gatgccgggc ggctcttgct tgaacatggg agtaaagtgc       600
     ctgggctatg gatactaa                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page