(data stored in ACNUC10043 zone)

EMBL: AP011532.PE436

AP011532.PE436       Location/Qualifiers
FT   CDS_pept        437336..438322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0436"
FT                   /product="putative thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0436"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60508"
FT                   /db_xref="GOA:D1YVN6"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011413"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR017668"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVN6"
FT                   /protein_id="BAI60508.1"
FT                   /translation="MKLEILAGALRDYLGTTRKHTIKNIVGIFDEKGTNPSFGEDAAII
FT                   DNGEYALLLAADGIWDKLMRVDPEWSGYCSVLVNVHDIAAMGGRPLGMVDVFSSNSDEI
FT                   TQRVLKGMKAGIDKFGVPIVGGHVHPDTPYAALDVAILGIAKKDTVIYSSTAKPGDDVV
FT                   LAIDMDGRVHPSCDLNWDTTFLKDASIVRQQVGSMVELAERKMLTAGKDVSNPGIIGTL
FT                   GMLLEVSGVGADVDMSAMPKPESLEWEHWLKMYPGMGFIVTCKPENTEQVLDIYRNHKL
FT                   NATKVGKIVSAPRLDLVKGKERATVFDFTKHEITGLGPARGRWCNNH"
     ttgaaactcg agatacttgc aggggcgctt cgcgattatc tgggaactac ccgcaagcac        60
     accattaaaa acatcgttgg catcttcgac gagaagggca cgaacccctc gttcggcgag       120
     gacgccgcca tcatcgataa cggcgagtac gctttactat tagcggccga cggcatctgg       180
     gacaagctca tgagggtcga ccccgagtgg tccgggtact gctcggtgct cgtcaacgtc       240
     catgacatcg ccgccatggg cggcaggccc ctgggcatgg tggacgtatt ttcctctaac       300
     tccgacgaga tcacgcagcg agtcttaaag gggatgaagg ccggcatcga taagttcggc       360
     gtgcccatcg tgggcggcca cgtgcacccc gacactcctt atgcggccct cgacgtggcc       420
     atcctgggca tcgcgaaaaa ggatacggtc atttacagca gcacggcgaa gccgggcgac       480
     gacgtagtcc tggccatcga catggacggc cgggtccacc cctcctgtga cctcaactgg       540
     gacacgacgt tcctgaagga cgcctccatc gtaaggcagc aggtcggttc catggtggag       600
     cttgccgaaa ggaagatgct cacggctggc aaggacgtca gcaaccccgg catcatcggg       660
     acgctgggca tgctcctcga agtctctggc gtgggcgccg acgtggacat gagcgccatg       720
     ccgaagcctg agagcctcga atgggagcac tggctcaaga tgtacccggg catgggcttt       780
     atcgtgacct gcaagcctga gaacacggag caagtccttg acatttaccg gaaccacaag       840
     cttaatgcta caaaggtcgg taagatagtc tccgcccccc gcctcgacct cgtcaaaggc       900
     aaggagaggg ccacggtgtt cgacttcacg aagcacgaga tcaccgggct cgggcctgcc       960
     aggggccggt ggtgcaataa tcactaa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page