(data stored in ACNUC10043 zone)

EMBL: AP011532.PE443

AP011532.PE443       Location/Qualifiers
FT   CDS_pept        444783..445307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0443"
FT                   /product="hypothetical protein"
FT                   /note="Contains at least Tetratricopeptide region domains
FT                   (IPR013026).; Contains at least three Tetratricopeptide
FT                   TPR_1 repeats (IPR001440).; Contains for Tetratricopeptide
FT                   TPR_2repeats (IPR013105)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0443"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60515"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVP3"
FT                   /protein_id="BAI60515.1"
FT                   /translation="MCEDPHPSSPGPKKPKKLSEEMDADSHIREGNALLLVGRIDEAIE
FT                   EYRAALDKDPENAEVHYNLGLIYRKTMQLDDAIREYREAIRVDPGNMKYHNNLAAALVV
FT                   KGQKSEAVKEYEEALRIEPKNATLHFNRGFALDEMGELQEAKKEYEEALRIDPGFDHAM
FT                   FYLGMLKKKLK"
     atgtgtgagg accctcaccc ctccagtccc ggcccgaaga agccgaaaaa actctctgag        60
     gaaatggacg ccgattccca tatccgggaa ggtaatgctc ttttattggt cggccgcatc       120
     gacgaggcca tcgaggaata tcgggccgcc ctggataaag acccggagaa tgcggaggtc       180
     cattataacc tgggcctgat ctatcgaaag acaatgcagc tcgacgacgc gatacgggag       240
     taccgggaag cgatacgcgt tgatccggga aatatgaaat atcacaataa cctggccgcg       300
     gcgctcgtcg tcaagggcca gaaatccgag gctgtaaagg aatacgagga agcactgagg       360
     atcgagccga agaatgcgac gctgcacttt aaccggggat tcgcgctgga cgagatgggc       420
     gagctgcaag aagcgaaaaa ggaatacgag gaagcactga ggatcgaccc gggcttcgat       480
     catgctatgt tttacctggg aatgctcaag aaaaagctca agtaa                       525
//

If you have problems or comments...

PBIL Back to PBIL home page