(data stored in ACNUC10043 zone)

EMBL: AP011532.PE447

AP011532.PE447       Location/Qualifiers
FT   CDS_pept        complement(448820..449509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60519"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVP7"
FT                   /protein_id="BAI60519.1"
FT                   /translation="MIYLAMDDTDNLESRGTGRLARAIAVELSRRYHVMGVTRHQLFVH
FT                   ESIPFTSHNSCAVIHIQGDSGMDDIFDTAKKLMLDDFVEGSDPGIAVASSRQVNSGVVA
FT                   FGQDAKCIVVNQERARSVAANAGIRLEGLGGTEGGVIGSVAGIGLAASGSDGRFLLRGR
FT                   NRELIGPQPVWALLSSGIDQVMTIDGRLVNDGMIAIRKSPTPSFVQGRAVLFVEESDGG
FT                   YVALKRP"
     atgatatatc ttgcgatgga cgacaccgat aatttagagt cacggggcac gggaaggctg        60
     gccagggcca tagcagtaga gctttcaaga agataccatg tgatgggcgt cacccggcat       120
     cagctcttcg tccacgagtc cataccgttc acgtcgcata atagctgtgc cgtcatccac       180
     atccagggcg attcgggcat ggacgatatt ttcgacaccg ctaaaaagct gatgctcgac       240
     gacttcgtcg agggcagcga ccccgggatc gccgtcgctt cctcgaggca ggtcaactcc       300
     ggggtggtcg ccttcgggca ggacgcaaag tgcattgtcg ttaaccagga aagggcccgc       360
     tccgtggcgg ctaacgccgg catacgcctc gaaggcctgg gcggcaccga gggaggagtc       420
     atcggctccg tggcgggaat agggctcgcc gcatcgggaa gcgacgggcg gttcttattg       480
     agggggcgca accgggagct catcggaccc cagcccgtat gggcgttgtt gagctcgggc       540
     atcgaccagg tcatgaccat cgacgggcgc ctggttaatg atggcatgat cgccatccgc       600
     aaatcgccta cgccgtcgtt cgtgcaggga cgagcggtgc tgttcgtgga agagtctgat       660
     ggtggctatg tggccctgaa aaggccttaa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page