(data stored in ACNUC10043 zone)

EMBL: AP011532.PE450

AP011532.PE450       Location/Qualifiers
FT   CDS_pept        complement(451658..452521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0450"
FT                   /product="putative cobalt ABC transporter ATP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60522"
FT                   /db_xref="GOA:D1YVQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVQ0"
FT                   /protein_id="BAI60522.1"
FT                   /translation="MLEYDSHCACPVKRNDDIIHVDCASHIYPDGVQGIHNMCFHVHER
FT                   EIVAVCGGNGSGKSTLLEHLNGLLLPSSGRVYVMGEELTGATKNEIWRYVGLVFQRPED
FT                   QLFAPTVLDDVMFGPLNMGMSMPEARKAAVEALESVGATGMDDRLPAYLSGGQKRLVAI
FT                   AGVLAMKPRVIAMDEPTSDLDTWHSELIERIIVRLRNEFGISVVMATHDLDMVARLADR
FT                   VCILKRGAIVGEGTPRDIFYNRALVEGSGLAVPKVVEIYHDYCYHFNKEPDMRPLNVHE
FT                   LIEAMR"
     atgctcgaat atgacagcca ctgcgcctgc ccggtgaaga ggaacgatga catcatccac        60
     gtcgactgcg cctctcacat atatcctgac ggcgtccagg gcattcacaa catgtgcttc       120
     cacgtccacg agagggagat cgtagcggtt tgcgggggca acggctccgg aaaatcgacg       180
     ctgctggagc acctgaacgg gctgctgctg ccgtcgtcgg gaagggtgta cgtcatgggc       240
     gaggaactga cgggcgccac gaagaatgag atatggcgat acgtggggct ggtgttccag       300
     cggcccgagg accaattatt cgctcctact gttttagatg acgtcatgtt cggcccgctg       360
     aacatgggca tgagcatgcc cgaagcccgt aaagcggccg ttgaggcgct ggagagcgtg       420
     ggcgccacag gcatggacga ccgactgccc gcgtacctct cgggcgggca aaagaggctc       480
     gtggctatcg caggggtgct ggcgatgaag ccccgggtca tcgcgatgga tgagcccacg       540
     tcggacctgg acacctggca tagtgagttg atcgagcgca tcatcgtccg gctcaggaac       600
     gagttcggca tcagcgtggt catggcgacc cacgacctgg acatggtcgc aaggctggcc       660
     gacagggtgt gcatcctgaa gcgcggggcc atcgtcggcg aggggacgcc cagggatatt       720
     ttttataaca gggcgctggt cgagggctcg ggcctggccg tgccaaaagt ggtcgagata       780
     taccatgatt attgctacca cttcaacaag gagcccgaca tgcgcccgct caacgtgcac       840
     gagcttatcg aagcaatgcg gtag                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page