(data stored in ACNUC10043 zone)

EMBL: AP011532.PE457

AP011532.PE457       Location/Qualifiers
FT   CDS_pept        457154..457672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0457"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60529"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVQ7"
FT                   /protein_id="BAI60529.1"
FT                   /translation="MDKYVNFAKTWKSVGVTNRLRWQQNNSLGRFNKYLLIRFIDRYGE
FT                   KALEVISETGLAVGYDDGKKIVDNLNLDSNSLRALLIPMEAISLLAGVDSDILVESSYG
FT                   PGTICLKVGDCIYATLFDGMNVGADFKTNACVSYSTGLTHAVSERSKVKVVKRRCAGDK
FT                   YCEFVVSLG"
     atggataaat acgtgaactt tgcaaaaacc tggaagtcgg tgggcgtgac caacaggctc        60
     aggtggcagc agaataactc gctgggccgt ttcaacaagt acctgttaat acgtttcatc       120
     gatcgttatg gcgagaaggc cctggaggtc atctccgaga ccggcctggc cgtgggctac       180
     gacgacggca agaagatcgt cgataacctg aacctggact ccaactcgtt aagggcgctg       240
     ctcataccca tggaggccat atctctcctt gcaggcgtcg actcggacat cctggtggaa       300
     agcagctacg gccccggcac gatctgcctg aaggtgggcg actgtattta tgccaccctg       360
     ttcgacggca tgaacgtggg cgccgacttc aagaccaacg cctgcgtgag ctattctacg       420
     ggcctgaccc acgccgtgag cgagaggtcc aaagttaaag tcgtcaagcg caggtgcgcc       480
     ggcgataagt actgtgagtt cgtggtgagc ctgggatga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page