(data stored in ACNUC10043 zone)

EMBL: AP011532.PE458

AP011532.PE458       Location/Qualifiers
FT   CDS_pept        457669..458436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Abortive infection protein family
FT                   (IPR003675)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0458"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60530"
FT                   /db_xref="GOA:D1YVQ8"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVQ8"
FT                   /protein_id="BAI60530.1"
FT                   /translation="MRRGLKLLAVFLFYLLNAWLVVSFSSLAGILTYPLIIILSVFFIA
FT                   VFELQVPWKGFAEGAIFAAVPMGLVLAVLLLSGAITPGPIREDFSYYLLLGVFVQLLVS
FT                   FGEELGFRAAIFQGLFDELGLWPAALLSAAGFAALHLPSMGIVGLGRQSDLIALGTIFL
FT                   AGIVLALLYRYGGLLNAIAFHFVWNFIEYNLFELGPLEGAILVSKPGPDIITGGAFGPE
FT                   ASVVTLAVTALLIVAVWLYYNKVRKPANSLSAP"
     atgaggcgcg gcctcaagct gctcgccgtt tttctgtttt atcttttgaa cgcctggctc        60
     gtggtgtctt tttcgtcgtt ggccggcata ctgacgtatc cgctgatcat tatcctgtcg       120
     gtcttcttta tcgcggtctt cgagcttcaa gttccctgga aaggtttcgc ggaaggggcg       180
     atcttcgcgg ctgttcccat gggcctggta ctcgccgtgc tcctgctttc tggcgccatc       240
     actcccggcc ccatccggga ggatttttcg tactacctac tactgggcgt attcgtgcag       300
     cttctggtca gtttcggcga agagctgggt ttcagggccg ccattttcca gggcctcttc       360
     gacgagctcg gcctctggcc tgcggcgctc ctttcggcgg cgggattcgc cgcgttgcac       420
     ctgccttcta tgggcatcgt aggcctgggc aggcagtcgg acctgatcgc gctgggcacc       480
     atcttcctgg cggggatcgt gctggccctg ctctaccgtt atggaggcct gctcaacgcc       540
     atcgcgttcc acttcgtctg gaatttcatc gagtataacc tgttcgagct ggggccgctg       600
     gagggggcta ttcttgtgtc taagcccgga cccgacatca tcacgggcgg cgccttcggc       660
     ccggaggcct ccgtcgtcac gctggccgtg accgccctgc ttatcgtcgc cgtatggctg       720
     tactacaata aggtgcggaa gcccgctaat tccttgtctg cgccttaa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page