(data stored in ACNUC10043 zone)

EMBL: AP011532.PE465

AP011532.PE465       Location/Qualifiers
FT   CDS_pept        complement(463028..463558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0465"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60537"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVR5"
FT                   /protein_id="BAI60537.1"
FT                   /translation="MKLDKEPCGLRILTEIVINRSGINYDDYLLGRTCRRCKRLMLEGN
FT                   ITKIPEDSNFRIVVKTPDGMPNILKGSELLTVSCKCGATYNIIFYGPVQYNSAGIVAYT
FT                   IIQMNGAEVELSDALDDMRKHKDAPADVDRWIVETLADEFNDAVRIVNEKGVSLVEEDW
FT                   TESKYSTGWIEEE"
     atgaaactcg ataaagaacc ctgcgggctg cggatactga ccgagatcgt catcaacagg        60
     agcggcatca actacgacga ttacctgctg ggcaggacct gccgccgctg caagcgcctg       120
     atgcttgagg gcaatatcac gaaaataccg gaggacagca acttccgcat cgtggtcaag       180
     acgcctgacg gcatgcccaa catactcaaa ggctccgagc ttttaacggt ctcgtgcaag       240
     tgcggcgcga cctacaacat catcttctac ggccctgtcc agtacaacag cgccggcatc       300
     gtcgcataca ccatcatcca gatgaacggc gccgaggtag agctttcaga cgccctggac       360
     gacatgcgta agcacaagga cgcgcccgcg gacgtggacc ggtggatagt cgagacgctg       420
     gccgacgagt tcaacgacgc cgtccgcatc gtcaacgaga agggcgtctc cctggtagaa       480
     gaggactgga ccgagtctaa atatagcacc ggctggatcg aggaagaata g                531
//

If you have problems or comments...

PBIL Back to PBIL home page