(data stored in ACNUC10043 zone)

EMBL: AP011532.PE467

AP011532.PE467       Location/Qualifiers
FT   CDS_pept        complement(464852..465121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0467"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60539"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVR7"
FT                   /protein_id="BAI60539.1"
FT                   /translation="MMLKLNIFNRRPQPQKKCYFEKDRTCDRECRAFDRDKERCTIVVR
FT                   LKEEADAGEAARMLKALCAIDSDPEMIAEAFPELVPPPRLVYED"
     atgatgctca agctgaatat ttttaacagg cggccgcagc cacagaagaa gtgctacttc        60
     gaaaaggacc ggacctgtga cagggagtgc cgggcctttg accgggataa ggagaggtgc       120
     actatcgtcg ttcgccttaa ggaggaggct gacgcgggcg aggccgcgcg gatgctgaag       180
     gcgctctgtg ccatcgacag cgaccctgag atgatcgccg aggcgtttcc cgagcttgtg       240
     ccgccgccca ggctggtcta cgaagattaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page