(data stored in ACNUC10043 zone)

EMBL: AP011532.PE472

AP011532.PE472       Location/Qualifiers
FT   CDS_pept        complement(469685..470035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis domain (IPR003731)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0472"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60544"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVS2"
FT                   /protein_id="BAI60544.1"
FT                   /translation="MKICVPMKSTMVHNHFGKASEFMLLMVEESKVVSRETIKNPGREK
FT                   GAVLELMPAHGVTHVISGGMGERVKGIMRERNIVVVTGALGSIDNAVERFLKGELKPVE
FT                   APCCGENLCGKK"
     atgaagatct gtgtcccgat gaagagcacc atggtgcaca accacttcgg gaaggcctct        60
     gagttcatgc tcctcatggt ggaggagagt aaggtcgtgt cccgggagac aattaagaac       120
     cctgggcgcg agaagggcgc agtgcttgag ctgatgcccg cccacggcgt tacgcacgtc       180
     atctcgggcg gcatgggcga gcgagtaaaa ggcattatga gggagcgcaa catcgtcgtc       240
     gtgaccggcg cactgggatc gatcgacaac gcggtcgagc gtttccttaa gggcgagctg       300
     aagcccgtcg aagcgccgtg ctgcggcgag aacctgtgcg gtaaaaaata g                351
//

If you have problems or comments...

PBIL Back to PBIL home page