(data stored in ACNUC10043 zone)

EMBL: AP011532.PE48

AP011532.PE48        Location/Qualifiers
FT   CDS_pept        37374..37940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0048"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60120"
FT                   /db_xref="GOA:D1YUJ8"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUJ8"
FT                   /protein_id="BAI60120.1"
FT                   /translation="MVKTPEFLKAFAEKYPGVYGLLQDVAFSLAVVAVIAAALYLYAGM
FT                   WPPMVSVNGISMYPNMENGDLVFIQGLGRGDVQTFENSTSTGYIMYNNYGDVIVYEPYG
FT                   DTSRPYVIHRAMKWVNKGDVMYTDSMGVEHIAQESGFMTLGDNNGGIYDQMAPTICYDQ
FT                   PVQKKWILGIARFKLPYLGYLRSLI"
     atggtgaaga cacccgagtt cttaaaggcg ttcgcggaga aatatccggg agtttacggg        60
     ctcttacagg acgtggcctt ctccttggca gtagtggccg tcatcgcggc ggcactgtat       120
     ttatacgcgg gcatgtggcc cccgatggtc agcgtgaacg gcatcagcat gtaccccaac       180
     atggagaacg gcgacctggt ctttatccag gggctgggcc ggggcgacgt ccagacattc       240
     gagaactcca cgtcgaccgg atacataatg tacaacaact atggggatgt gatagtctac       300
     gagccttacg gcgacacgtc gaggccatac gtgatccacc gggccatgaa gtgggtgaac       360
     aagggcgacg tgatgtacac cgacagcatg ggcgtggagc atatcgccca ggagtccggg       420
     ttcatgaccc tcggcgataa taacggaggc atctacgacc agatggcccc cacgatatgc       480
     tacgaccagc ctgtgcagaa gaagtggatc ctggggatcg cccggttcaa gctgccctac       540
     ctcggctacc tgcgctcgct catctga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page