(data stored in ACNUC10043 zone)

EMBL: AP011532.PE487

AP011532.PE487       Location/Qualifiers
FT   CDS_pept        483053..484387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains at least two Regulator of chromosome
FT                   condensation, RCC1 repeats (IPR000408)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0487"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60559"
FT                   /db_xref="GOA:D1YVT7"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVT7"
FT                   /protein_id="BAI60559.1"
FT                   /translation="MRGFRLILLILICSFSLVLIMPCVTAWSPAVVSIAASNSTSVALL
FT                   DDGTVWQWGYVSDGVEYATPQKVEISVVRKIAAGYGHVLALKGDGTVWAWGSNKYGQLG
FT                   DGTYNDSAGPVQVAGLTGVKAIAAGKDISLALKGDGTVWAWGSNSYGQVGEGSLNYKGT
FT                   AVPIQVKGLNNIQAISAGGSHCLASQGDGAVWAWGDNRHGVLGDGTNESRFTPVRSKIY
FT                   NVMGLDAGDAHALAVMVDGNVWSWGYNYNGQLGMGGTSLNDLGRLSFGPEADSFNPDIV
FT                   RGLSGVKSVAVGASHSVALADNGTVWTWGSNSDGQLGVGKTGGSDMTVPVRVSGINGIT
FT                   AVDAGLYHTLALKDDGSVWAWGSNAEGQVGNRSASAGSPALVLMQTQILPSPTSTPIIV
FT                   TASPTTPESGPNYMLIGSIALLAVIVIVVVTACVLLLRSRKKGSG"
     atgaggggtt tccggcttat cttgctcatc cttatatgtt cgttctcgct cgttctcatt        60
     atgccctgtg tgactgcctg gtcgcccgcg gtcgtttcca tcgccgcgtc caactcgact       120
     tccgtggcat tgctcgacga cggcaccgtg tggcagtggg gctacgtgag tgacggcgtc       180
     gaatatgcga cgccccaaaa ggtagagatc tcggtcgtaa ggaagatcgc ggccgggtac       240
     ggccacgtgc ttgctctgaa gggagacgga actgtttggg cctgggggtc gaacaagtac       300
     ggacagctcg gggacggcac atataacgac agcgccgggc cggtccaggt agcggggctc       360
     acgggcgtca aggccatcgc cgccggcaag gacatcagcc ttgctctgaa gggcgacggc       420
     acggtgtggg cctggggctc caactcgtac ggccaggtag gcgagggctc gctcaattat       480
     aagggcacgg ccgtgcccat ccaggttaag ggcctgaaca atatccaggc catatcggcc       540
     gggggctcgc actgcctcgc atcgcaggga gacggcgcgg tgtgggcctg gggcgataac       600
     cgccacggcg ttttgggaga cggcaccaac gagagccgct ttactcccgt ccggtctaag       660
     atctataacg tgatgggcct cgacgcgggc gacgcccacg cgctggccgt catggtggac       720
     ggcaacgtct ggtcatgggg ctataattat aacggccagc tcggcatggg cggcacgagc       780
     ctgaacgacc tcggccggct ctcattcggg ccggaggcgg actcttttaa ccccgatatc       840
     gtccggggtt tatccggcgt gaagtcagtg gcagtgggcg cctcgcactc cgtcgcgctg       900
     gccgataacg gcaccgtctg gacgtggggc agtaactcgg acggccagct aggtgtcggt       960
     aaaacagggg gaagcgacat gaccgtgccc gtgcgggtga gcggcattaa cggcatcacc      1020
     gccgtcgacg cgggcctcta tcatacgctg gccctcaaag acgacggcag cgtatgggcc      1080
     tggggctcga acgctgaggg ccaggtcggt aacaggagcg cctccgcggg ctctcctgcg      1140
     ctcgtgctca tgcagacgca gatactgcct tcgccgacgt ccacgcctat catcgttacc      1200
     gcttctccga ctaccccgga gagcgggccg aactacatgc ttatcggttc catcgcactt      1260
     ctggccgtca tcgtaatagt cgtcgtcaca gcgtgcgtgc tattgcttag aagtagaaaa      1320
     aagggctccg ggtaa                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page