(data stored in ACNUC10043 zone)

EMBL: AP011532.PE494

AP011532.PE494       Location/Qualifiers
FT   CDS_pept        491266..491655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0494"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60566"
FT                   /db_xref="InterPro:IPR026350"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVU4"
FT                   /protein_id="BAI60566.1"
FT                   /translation="MEPIPEEIEKIVTQIIDAAYNVHAYTGNGLLESAYEACMLIELEK
FT                   KGLTVENQILLPIIYDGHIIPNAYRLDILVNKCVIVEIKVVEDILPVHISQVLTYLRFT
FT                   DLRIGLIINFNKKYFGDAVRRVKRK"
     atggaaccta ttcccgaaga aatagaaaag atcgtgaccc aaattatcga tgcagcatac        60
     aatgtccacg catacacagg caacggactg ctcgaaagcg catacgaagc atgcatgctc       120
     atcgaactgg aaaagaaagg attgactgtt gaaaaccaga tactattacc tattatatac       180
     gacggccaca tcatacccaa cgcctaccgc ctcgacatcc tggtaaacaa atgcgtaata       240
     gttgaaataa aagtcgtcga agatatactc ccggtacaca tatcccaggt actaacatac       300
     ctgagattca ccgatctcag aataggcctg atcataaact ttaacaaaaa atacttcggc       360
     gatgcagtca ggagagtaaa acgaaaataa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page