(data stored in ACNUC10043 zone)

EMBL: AP011532.PE501

AP011532.PE501       Location/Qualifiers
FT   CDS_pept        496357..496737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0501"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60573"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVV1"
FT                   /protein_id="BAI60573.1"
FT                   /translation="MIKQLVDTVRGADGYAGMAVYRGDGMLFSEGLEPAYTDMIKALFE
FT                   EIGGHFSARGVSLVIRGYTVRAFLAEDKLVICRSEGRFMAMPVLRDREPEYAAGQAPPG
FT                   LITKEEARKEAAAMLKLLMSSG"
     gtgattaagc agcttgtgga cacggtgagg ggcgcggacg gatacgcggg catggccgtc        60
     tacaggggcg acggcatgct gttttcggag gggctggagc ccgcctatac ggacatgata       120
     aaggcgctgt tcgaagagat cggcgggcat ttttcggcga gaggggtttc acttgtcatc       180
     cggggctaca ctgtccgggc gttcctggcc gaggacaagc tcgtgatatg caggtccgag       240
     gggcggttca tggccatgcc cgtcctgcgt gacagggagc ccgagtacgc cgcaggccag       300
     gctcccccgg gccttataac gaaggaagag gcgagaaaag aggccgcagc aatgcttaag       360
     ttgctcatgt cgtcaggata a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page