(data stored in ACNUC10043 zone)

EMBL: AP011532.PE502

AP011532.PE502       Location/Qualifiers
FT   CDS_pept        496798..497295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60574"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVV2"
FT                   /protein_id="BAI60574.1"
FT                   /translation="MAKSYSDIIQEREAILGTFEALFKARGLGALHGRVFGAILLAVDP
FT                   VTQDEISEFTGYSVPAVSSALEELVRVGLVARQKRQESRKNYYSSRANLDEIMRMVLKT
FT                   IHDDYVLVVLNRLQYSKADAEGTQDPKLSEHVEFIENYEARLRDLESYMNRLLDVPLEE
FT                   KK"
     atggccaagt cttactctga catcatccag gagagggagg caatactggg cacattcgag        60
     gccctgttca aggcccgtgg cctgggcgcg ctccacggcc gggtcttcgg cgccatactt       120
     ctggcggtcg atcccgtgac ccaggatgag atcagcgagt tcaccgggta ctctgtgccg       180
     gcggtcagct cagcgctcga agagctggtc agggtgggcc ttgtagccag gcaaaagcgg       240
     caggaaagcc gcaagaacta ctactcgagc cgggctaacc tcgatgagat catgcgcatg       300
     gtgctcaaga cgatccacga cgactacgta ctcgtggtgc tcaatcggct tcagtattcg       360
     aaggccgacg ccgagggcac gcaggaccct aaattaagcg agcacgtcga gttcatcgag       420
     aactacgagg ccaggctcag ggacttagaa tcatacatga atagattact ggacgtacca       480
     ctggaggaga aaaagtga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page