(data stored in ACNUC10043 zone)

EMBL: AP011532.PE506

AP011532.PE506       Location/Qualifiers
FT   CDS_pept        complement(499214..499681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60578"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVV6"
FT                   /protein_id="BAI60578.1"
FT                   /translation="MNGEFALGPDEILFLFDGDNTVGIVKAGHLKRVFIETEDEELVQF
FT                   LGPEDLIAASCFEGGEKAREMVRSMLFLVREGGTPLLVLRKSHPATQRLKLVVSAGDRI
FT                   VLSGCIVPGTHPEQDVLCGKGAMDGIVLEAGEGRVLARGGGSPHAEKGRFL"
     gtgaacggcg agttcgctct cgggcccgac gagatcttat ttttattcga tggcgacaat        60
     accgtgggaa tcgttaaagc gggccatttg aaacgtgtat tcattgaaac ggaggacgag       120
     gagctcgtcc agttccttgg cccggaggac ctgatagctg cctcatgttt tgagggcggc       180
     gaaaaagccc gggagatggt aaggagcatg ttatttctgg tgagggaggg cggcacgccg       240
     ctgctcgtgc ttcgtaagtc ccacccggcc actcaaaggc tgaagcttgt cgtctcggcg       300
     ggcgatagga tcgtgctgag cgggtgtatc gtgccgggca cccacccgga acaggacgtg       360
     ctctgcggca agggcgcgat ggatggcatc gtgctggaag cgggcgaggg gagagtgctc       420
     gcccggggag gaggctcgcc gcatgccgaa aaagggcgtt ttttatag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page