(data stored in ACNUC10043 zone)

EMBL: AP011532.PE508

AP011532.PE508       Location/Qualifiers
FT   CDS_pept        complement(499857..500438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0508"
FT                   /product="putative fumarate hydratase class I beta subunit"
FT                   /note="Similar to L(+)-tartrate dehydratase subunit beta
FT                   TtdB in Escherichia coli. (P0AC35)"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0508"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60580"
FT                   /db_xref="GOA:D1YVV8"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVV8"
FT                   /protein_id="BAI60580.1"
FT                   /translation="MEYHLTTPLSKEPLKALRAGDVVYITGEFITARDKAHARMAEYFK
FT                   GHRQLPFKLEGAAIFHGAPIVKKEGEEWKIVAIGPTTSARMNDLEPAVIGHGAAAIIGK
FT                   GGMGPDVLAALRDNGAVYLSMTGGTAVLGARMVKKVLGLIWEDLGMSEAVWLLEVENFG
FT                   PLTVTMDAHMGDLYEAVRRRASENIKDMRL"
     atggaatatc acctcaccac gcctctctcg aaagagcccc tcaaagctct aagggccgga        60
     gacgtagtct atattactgg cgaatttatc acggccaggg acaaggcgca cgcccggatg       120
     gccgagtatt tcaaagggca ccggcagctt ccctttaagc tggagggagc ggcgatcttc       180
     cacggcgccc ccatcgtgaa gaaggagggc gaggaatgga agatcgtggc aatcggcccc       240
     acgaccagcg cgcgcatgaa cgacctggag cccgccgtca tagggcacgg cgcggccgcc       300
     atcatcggca agggcggcat gggcccggac gtactggccg cgctccgtga caacggcgcc       360
     gtgtatctct ctatgacggg agggacggcg gtgctgggcg cacgcatggt gaaaaaggtg       420
     ctcggcctca tctgggagga cctgggcatg tcggaggccg tgtggctgct cgaggtggag       480
     aatttcggcc ctctcacggt gaccatggac gcgcacatgg gcgacctgta cgaggcggtc       540
     aggcgcaggg cctcggaaaa tattaaggat atgcgcctct aa                          582
//

If you have problems or comments...

PBIL Back to PBIL home page