(data stored in ACNUC10043 zone)

EMBL: AP011532.PE520

AP011532.PE520       Location/Qualifiers
FT   CDS_pept        511044..511433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis domain (IPR003731)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60592"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVX0"
FT                   /protein_id="BAI60592.1"
FT                   /translation="MEASNTTRIAIPSMTEGGLESDICAHFGSCEFFTLVDISNGKPVG
FT                   VNALSNASPDGVHNCAAPAILLKESGVDVVIVSGIGGRPLVSLTSKGIRVYGGAFGRVS
FT                   DALQDFSSGALNELSDQGTCNCSHH"
     atggaagcga gtaatacgac aaggatcgca ataccatcta tgacggaagg tggactcgaa        60
     tcggacatat gcgctcattt cggctcatgc gagtttttca cgctcgtgga tatctcgaac       120
     gggaagccgg tcggcgttaa cgccctgagt aacgcgtcgc cggacggcgt gcacaactgc       180
     gccgcccccg caatactgtt aaaggaaagc ggcgtggacg tggtcatcgt ctcggggatc       240
     gggggcaggc cgctggtatc actgaccagc aagggcatac gcgtctacgg aggcgctttc       300
     ggcagagtat ccgacgccct ccaggacttc tcctccggcg ccctgaacga gctatccgac       360
     cagggcacct gtaactgctc acaccattag                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page