(data stored in ACNUC10043 zone)

EMBL: AP011532.PE524

AP011532.PE524       Location/Qualifiers
FT   CDS_pept        514981..515877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0524"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60596"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVX4"
FT                   /protein_id="BAI60596.1"
FT                   /translation="MTDPCASFGDGFVKAHDGVGLYYRQWSPPVEVTSFVLFIHGIGLH
FT                   GSSPPYGEKILIRQLLDRGTAFYSIDLRGHGMSGGSIDGISRDTLIKDIDSHVEHIHEQ
FT                   YSSARIFLYGHNFGGILALYYASRCPKNLRGIIMSEYSTRIRDEVKKIREPTAAIALKE
FT                   RLVEKLYKRSKKLEILSPDDYEQLCDKYRIPMDAGIMRSLETSGSGRKCMLYGKDFFTA
FT                   CGVGQDAAIAGAVRLPFLTIFSRNDPFFDIRGAYDILTRVQSYDKELTQVDAAGHYGII
FT                   EASKDIVGKWVLSRTTK"
     gtgaccgatc cgtgtgcctc atttggcgac ggcttcgtga aggcgcacga tggcgtcggc        60
     ctttattatc ggcaatggtc gcctcccgtg gaagtgactt cctttgtcct gttcatccac       120
     ggcataggcc ttcacggaag ctctccccca tacggagaaa agatcctgat caggcaatta       180
     ctggaccggg gtacggcttt ttattctatc gacctccggg gccatggcat gtccggaggc       240
     agcatcgacg ggatctcccg ggatactctt ataaaagata tcgatagcca tgttgagcat       300
     atccatgagc agtatagtag cgccaggata tttttgtacg gccataattt cggaggcata       360
     ctggcactgt actacgcttc caggtgcccg aaaaacctgc gcggcatcat aatgtccgag       420
     tattcgacac ggatacggga tgaggtgaaa aagatccggg aaccgaccgc ggcgatcgcg       480
     ctcaaggaac gcctcgttga gaagctatat aaaagatcga aaaagctcga gatcctgtcg       540
     cccgatgatt acgagcagct ctgcgacaaa taccgtattc ccatggacgc cggcatcatg       600
     aggtccctgg aaacgtcggg aagcggccga aaatgcatgc tatatggcaa agacttcttc       660
     acggcttgcg gtgtcggcca ggatgccgcg atcgcagggg cagtcaggct gccctttctg       720
     actatattct cccgaaatga cccattcttc gacatccggg gagcctatga catccttacc       780
     cgcgtccagt cgtacgataa agagctgacc caggtggacg cggcgggcca ctatggcatc       840
     atcgaggcaa gcaaggatat cgtcggcaaa tgggtccttt ccaggaccac caaataa          897
//

If you have problems or comments...

PBIL Back to PBIL home page