(data stored in ACNUC10043 zone)

EMBL: AP011532.PE528

AP011532.PE528       Location/Qualifiers
FT   CDS_pept        518253..518582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis domain (IPR003731)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60600"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVX8"
FT                   /protein_id="BAI60600.1"
FT                   /translation="MKVCIPIEGTMVSQHFGHTPEFLIVTIEDGKAVSRKVEKSPGHEP
FT                   GLLPKLMASWGVTHVITGGLGRRALDMFEERNIRVISGVSGTADEALESFLGGKLVAGE
FT                   NMCDH"
     atgaaagttt gcatacccat tgaagggact atggtgtccc agcatttcgg ccacacgccg        60
     gaattcctga tagtgacgat cgaagacggc aaagccgtat ccaggaaagt cgaaaagagc       120
     cctggccatg agcccgggct cctgccgaag ctcatggcat cgtggggcgt cacgcacgtc       180
     atcacgggcg gcctgggcag aagggcgctg gacatgttcg aggagaggaa catacgggtg       240
     atctccgggg tctcggggac cgccgacgag gccttagaat cgttcctggg cggaaagctg       300
     gtcgccggcg agaacatgtg cgaccattag                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page