(data stored in ACNUC10043 zone)

EMBL: AP011532.PE53

AP011532.PE53        Location/Qualifiers
FT   CDS_pept        42433..43374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0053"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60125"
FT                   /db_xref="GOA:D1YUK3"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUK3"
FT                   /protein_id="BAI60125.1"
FT                   /translation="MKRVPDHPGTGLTGLTAAKIVLIYVFFGVIWILTSDLLVSRLSPN
FT                   STIYTTLSIAKGWMFILATSVLLYLLIRRYAAERNEIEARLQEARARAELYLDLMGHDI
FT                   TNMNQAGIGFLELAQEQLKLSDEDRQLIAIPQHSLRNSTRLIEYVRKLQRASAGGALRP
FT                   VDLGPALGSLATEYPAQDGRGITISYAGGSCHVMANDMLPDLFTGIIDSISRRSAGPAA
FT                   VDVRLERTEAGGVQYCRVVFEGSGWSCPPQAKEALAYDRLKGYGKTVDRDISMYLVREL
FT                   AENYRGSVYMEDRAADGQDGCRYVVLLPAIEK"
     gtgaagcgtg ttcctgatca cccgggtacg ggtctgacag ggctgacggc tgcaaagata        60
     gtgctcatct acgtcttctt cggcgttatc tggatcctga ccagcgacct gctcgtcagc       120
     cgcctgtccc cgaacagtac gatctataca acgctgagca tcgccaaagg ctggatgttc       180
     atcctggcca cttcagtgct cctctatttg ctgatacgac gctatgctgc agagcgaaac       240
     gagatcgagg ccaggttgca ggaggccagg gcaagggccg agctatacct ggacctgatg       300
     ggccatgaca tcaccaacat gaaccaggcc gggatcggtt tcctagaact ggcgcaggaa       360
     cagcttaagc tgagcgacga agatcgacag ctgatcgcca tcccgcagca ttcgctccgg       420
     aacagcacca ggctcatcga gtacgtacgg aagctgcagc gtgccagcgc cggcggcgcg       480
     ctccgcccgg tggacctcgg gccggcattg ggctcgctgg ccacggagta ccctgcccag       540
     gacggccgcg gaataacgat cagttacgca ggcggaagct gccacgtcat ggcgaacgac       600
     atgctgcccg acctgttcac cggcatcatc gacagcatct cccggcgctc cgccgggcca       660
     gcagccgttg atgtccggct tgaacgtacg gaggccgggg gtgtacaata ctgccgcgtg       720
     gtgttcgagg gcagcggctg gtcgtgcccg ccccaggcga aagaggcgct tgcctacgac       780
     cggctcaaag ggtacgggaa gaccgtggac cgggacatca gcatgtacct tgtccgtgag       840
     ctggcagaga actaccgggg cagcgtgtat atggaggacc gcgcggccga cggccaggac       900
     ggttgccgat acgtggtgct gctaccggcc attgagaaat aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page