(data stored in ACNUC10043 zone)

EMBL: AP011532.PE530

AP011532.PE530       Location/Qualifiers
FT   CDS_pept        518882..519211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis domain (IPR003731)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60602"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVY0"
FT                   /protein_id="BAI60602.1"
FT                   /translation="MSICITADGAYINGKVSEFFGRCKNFMLIDLETGELDIVPNMAAY
FT                   LNNAGLRAAADIIKHKPSAVIAGRIGKNALKALRKAGIEVLMAKNMTIREALEQYRSGK
FT                   LEKLR"
     gtgagcattt gtataacggc agatggtgcc tatatcaatg gtaaagtgag cgagttcttc        60
     gggcgatgta aaaatttcat gttgatcgac ctggaaactg gcgaactgga catcgtaccg       120
     aatatggcag cctacctgaa taatgcgggc ctgagggccg ccgcagacat tatcaagcat       180
     aagccttcgg ccgtcatagc cggcaggatc ggtaaaaatg ccttgaaggc cctgcgaaag       240
     gccggcatcg aagtgctcat ggccaaaaat atgaccatcc gggaagccct ggagcagtat       300
     aggtcaggga aactagaaaa attacgataa                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page