(data stored in ACNUC10043 zone)

EMBL: AP011532.PE535

AP011532.PE535       Location/Qualifiers
FT   CDS_pept        complement(521383..522816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0535"
FT                   /product="putative histidine kinase"
FT                   /note="Contains one PAS domain (IPR000014).; Contains one
FT                   PAS-associated, C-terminal domain (IPR000700).; Contains
FT                   one ATP-binding region, ATPase-like domain (IPR003594).;
FT                   Contains one PAC motif repeat (IPR001610)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0535"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60607"
FT                   /db_xref="GOA:D1YVY5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVY5"
FT                   /protein_id="BAI60607.1"
FT                   /translation="MYNAHKNPYPLSLGMYNQVVLALIIVACVFVTLYANFLLGIDAVY
FT                   THLYYLPIILAGIWYHRKSIYLALFLGLAHVSIGYYLAGSIVPSTLIRAVMFLVVAAVV
FT                   SLLSERRHTLYNETRLLLESTGEGIYGIDLEGRCTFINDSAARMLGYAPDEMIGKSTHD
FT                   LIHSRKMDGTPCVPEHCGVLQSIWTGEGCRISDDIFWRKDGTAIPVEYSSYPIIEDGLV
FT                   RGAVVTFNDISERKKSEEEIREAKRRSELFLDIMAHDINNMNQVGIGYLGMVLGALKPG
FT                   DKVDEDNIVMLERSLSSLENSSRLISNVRTLQEVETGKVRLKPINLCDVLSDVRDRYSR
FT                   VPGRNVSINYANSPECMLEANELLKDAFSNLVSNAVKHSDPAKPLTVDITQTRISDGGN
FT                   EYYMVTIADDGPGIPDDLKSKLFTKFQRGQTHAQGKGLGLYLVKSLVEDFRGRVWVEDR
FT                   VPGDHTKGARFVVMLPASA"
     atgtataacg cacacaaaaa tccataccct ttaagcctcg ggatgtataa ccaggtcgtg        60
     ctagccctca ttatcgtggc ctgcgtattc gtcacgctgt acgcgaactt cctgctcggc       120
     atcgacgccg tgtataccca cctgtattat ctgccgatca tcctggccgg gatatggtac       180
     catcgtaagt cgatctacct ggcgctattc ctcggcctgg cccacgtgtc gatagggtat       240
     tatctcgcgg ggagcatcgt cccgagcacg ctcataaggg cggtgatgtt tctcgtcgtc       300
     gccgctgtcg taagcctgct ctccgaaaga cggcatacat tatataatga gaccaggcta       360
     ttgcttgagt ccaccggcga gggcatctac ggcatagacc tggaagggcg ctgcacgttc       420
     atcaacgact cggccgcccg catgctcggc tacgcgcccg acgaaatgat cggcaaaagt       480
     acgcacgacc tgatacatag cagaaagatg gatggcaccc cctgcgtccc cgagcattgc       540
     ggcgtactac agtcaatttg gacaggggag ggctgtcgta taagcgacga catcttctgg       600
     aggaaggacg ggaccgctat ccccgtggaa tattcctcct atcctatcat cgaggacggc       660
     ctcgtaaggg gagccgtcgt gaccttcaac gatatctcgg agcgtaaaaa gtcagaggaa       720
     gagatacgtg aggctaagag aagatcggag ctattcttag atatcatggc ccacgatatc       780
     aacaacatga accaggtggg tataggctac ctgggcatgg tactgggggc cttgaagccc       840
     ggagataagg tcgacgagga taacatcgtc atgctggaaa gatcgctgag ctcgctggag       900
     aacagctccc ggctcatttc caacgtcagg acgctgcagg aggtggaaac gggcaaggtc       960
     aggctcaagc cgatcaacct gtgcgacgtg ctctccgacg tccgggaccg atattcccgc      1020
     gtcccgggcc gaaacgtctc cattaattac gccaattcgc cggaatgcat gctggaagcc      1080
     aacgagctgc tgaaggatgc gttctcaaat ctcgtgagca acgcggtgaa gcactccgat      1140
     ccggcaaagc cgttgaccgt cgacatcacg cagacccgga tctccgatgg cggcaatgag      1200
     tattacatgg tcacgatcgc cgacgacggg ccgggcatac ccgatgacct taaaagtaaa      1260
     ttgttcacga agttccagag gggccagacc catgcccagg gcaaagggct gggattatat      1320
     ctcgtgaagt ccctcgtgga ggacttccgt ggccgggtat gggtcgaaga ccgggtgccg      1380
     ggcgaccata cgaaaggcgc acggttcgtg gtcatgttac cggcgtccgc gtag            1434
//

If you have problems or comments...

PBIL Back to PBIL home page