(data stored in ACNUC10043 zone)

EMBL: AP011532.PE537

AP011532.PE537       Location/Qualifiers
FT   CDS_pept        complement(524244..524495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60609"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVY7"
FT                   /protein_id="BAI60609.1"
FT                   /translation="MGMLVTFEVMEKKGELVAVHDGSLGLLVALGNDWDMLRDTINETV
FT                   SDALGEVTADVEIELFIDANHRTRFKYVYDRAVADRTG"
     atgggtatgc ttgtaacctt cgaggtcatg gagaagaaag gggagctggt cgcggtccac        60
     gacggtagcc tcgggcttct cgtggccctg ggaaacgact gggacatgct ccgggatacg       120
     atcaacgaga ccgtctcgga cgccctggga gaagttaccg ccgacgtgga gatcgagctg       180
     ttcatcgacg cgaaccaccg gacccggttc aagtacgttt acgaccgggc cgtggccgat       240
     aggacagggt ag                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page