(data stored in ACNUC10043 zone)

EMBL: AP011532.PE538

AP011532.PE538       Location/Qualifiers
FT   CDS_pept        complement(524595..524933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF202
FT                   family (IPR003807)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0538"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60610"
FT                   /db_xref="GOA:D1YVY8"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVY8"
FT                   /protein_id="BAI60610.1"
FT                   /translation="MSTTTLAMQRNIMANERTFSAWLRTGLALIVAAIALPRIIHFVYW
FT                   AWTLKLIGLIFIAIATTVFIVAYWRYEAESKKLMCAGAVMTPAWLIKVLTILLMATSVI
FT                   SVALLLHE"
     atgagcacca ccaccctcgc catgcagagg aacatcatgg cgaacgagcg cactttcagc        60
     gcctggctca ggaccggcct ggcgcttatc gtcgcggcca tcgcgcttcc gagaattata       120
     catttcgtat actgggcgtg gacgctcaag ctgatcggcc tcatattcat agccattgcc       180
     acgacggtgt tcattgtagc ctactggcgc tatgaggccg agagtaaaaa gctgatgtgc       240
     gccggggcgg tcatgacgcc ggcgtggctc attaaagtat tgaccatcct gcttatggcc       300
     acgtcggtca tatcggtggc cctgctattg catgaatga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page