(data stored in ACNUC10043 zone)

EMBL: AP011532.PE54

AP011532.PE54        Location/Qualifiers
FT   CDS_pept        complement(43526..45574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0054"
FT                   /product="putative histidine kinase"
FT                   /note="Contains two PAS domains (IPR000014).; Contains two
FT                   PAS-associated, C-terminal domains (IPR000700).; Contains
FT                   one ATP-binding region, ATPase-like domain (IPR003594).;
FT                   Contains two PAC motif repeats (IPR001610)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0054"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60126"
FT                   /db_xref="GOA:D1YUK4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUK4"
FT                   /protein_id="BAI60126.1"
FT                   /translation="MVSKPDLQKKDEDKDKKELLEELKALRGHYSRLKAAVDRYERVAG
FT                   KKELYRGLYDLEAERDRIKAQHDELREDEARRKVADAVEFERKLLFDVLENLPAFIYLQ
FT                   ARDHSIRFANQTFRKIFGEPENRPCYELIQRSDAPCPDCPTFRVFDTLLPQQWEWTDKM
FT                   GNIYQIYDYPFTDVDGTPLVLEMGIDITERKRAEEARRESEANLAKAQRITHLGNWEWD
FT                   VKEDKVFCSDEFYRVFGLDRRDYITFAEFIDTLYPGDKDRVNRAVEAALYKGEPYSIDY
FT                   CVIWPDGSEHIIHAEGEVTYGQGGAPIKMFGTVQDITERKQAEEELLASEEKFRALADT
FT                   SFVTIAVHRGGNLLYVNNATVELTGHSKDELLKMQFWEVFAEDERESIKKRASDRLAGK
FT                   SASTSYETRILTKDGQTKWVNLTGGVFTFEGKPTIITTLFDITGIKNAENELKESKTQA
FT                   ELYVDLMSHDIRNMNQVGIGFLELALKSPDIDKKDKELLLKSMGALENSTRLIDNVRKL
FT                   QKSQTGELKPYAVDACEAIMRVLGHYSNMPGVKATFNYKLPPGCTVMANDLLYEVFENL
FT                   VGNAIKHAGPEPTINVKFEIIVFNGRNYNKFIVEDDGPGIPDDLKPRIFTRRIHSGART
FT                   RGSGLGLFIVKSLVDSYGGRVWVEDRVKGDHTKGARFVVMLPAIKAE"
     atggtctcca agccggattt acaaaagaag gatgaagata aggacaagaa agagctactc        60
     gaagagttga aggccctccg tggccattat tcccggctta aggccgcagt ggatcgttat       120
     gagcgggtcg cgggcaagaa ggagttatat cgtggcctgt acgacctcga agccgaacgt       180
     gaccgcatca aagcgcagca cgacgagttg agggaggacg aggcccgccg caaggtcgcc       240
     gatgccgtcg aattcgagcg gaagcttctc ttcgacgtgc tggaaaatct gccggctttc       300
     atatatttac aggcccggga ccactccata cgctttgcca accagacctt ccgtaaaatt       360
     ttcggtgagc ccgagaaccg tccgtgttac gagctcattc aacgcagtga tgcgccctgc       420
     cccgattgcc cgacgtttag ggtgttcgac actcttctgc cacagcaatg ggaatggacg       480
     gataagatgg gcaacatata tcaaatttat gattacccgt tcacagacgt cgacggtacg       540
     ccgctggtgc tcgaaatggg catcgatatc accgagcgca agcgagccga ggaggcgcgg       600
     cgagagagcg aggccaactt agcaaaagct caacgtatca cgcatttggg caattgggag       660
     tgggacgtga aggaagataa ggtattttgt agcgacgagt tctacagggt attcggcctg       720
     gaccgcaggg actacatcac atttgcagaa ttcatcgata cgctctaccc cggggacaag       780
     gaccgagtta accgggcggt cgaagcggcc ctgtataaag gagagcccta tagcatcgat       840
     tattgtgtca tctggcccga tggaagcgag cacattatcc atgcggaagg tgaagtcacc       900
     tatggtcagg gaggagcacc aataaaaatg ttcgggaccg tccaggatat taccgagcgc       960
     aagcaggcag aggaagagtt gctggcgagc gaggagaagt tccgtgcatt agctgacacg      1020
     tccttcgtca ctatagccgt ccataggggt ggtaatttat tatatgttaa caacgccact      1080
     gtagagctta cggggcattc taaggacgag cttttgaaaa tgcagttctg ggaagtattc      1140
     gctgaagacg agagggagtc tattaaaaag cgtgcctctg ataggcttgc cggcaaatcg      1200
     gcgtcaacta gctatgagac caggatttta acaaaggatg gtcaaaccaa atgggttaac      1260
     ctgacgggag gagtattcac ctttgagggt aaaccgacta ttattacgac tttgttcgac      1320
     attacgggca ttaaaaatgc ggagaacgag cttaaagagt ctaaaactca ggccgagctg      1380
     tacgtggacc tgatgagcca cgatatccgc aacatgaacc aggtcggcat tgggttcctc      1440
     gagctagcgt tgaaatcgcc ggacatcgat aaaaaggata aggagctatt gctgaagtcc      1500
     atgggtgcat tggagaacag cactcgacta atcgataacg tgaggaagct gcagaagtcc      1560
     cagaccggag aactaaagcc gtatgcggtg gacgcgtgtg aggccatcat gagggtgctc      1620
     ggccactact cgaacatgcc cggcgtgaaa gccactttca actataagct accaccgggc      1680
     tgcacggtca tggccaatga tttattgtac gaggtattcg agaacctcgt aggcaacgca      1740
     atcaagcatg ccggcccgga accgaccatc aacgtcaaat tcgaaatcat tgtgtttaat      1800
     ggcaggaatt acaacaagtt cattgtagag gatgatgggc cggggatacc cgacgaccta      1860
     aaaccgagaa tcttcacccg gagaatccat agcggcgcca ggactcgtgg cagtggcctc      1920
     ggactgttca tagtaaaatc gctcgtggac agctacggcg gccgcgtgtg ggtcgaggac      1980
     cgggtaaaag gagatcatac gaagggcgcc cggttcgtgg tcatgctgcc agccataaaa      2040
     gcagaataa                                                              2049
//

If you have problems or comments...

PBIL Back to PBIL home page