(data stored in ACNUC10043 zone)

EMBL: AP011532.PE551

AP011532.PE551       Location/Qualifiers
FT   CDS_pept        535623..535961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0551"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60623"
FT                   /db_xref="InterPro:IPR012031"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW01"
FT                   /protein_id="BAI60623.1"
FT                   /translation="MACLNDYDYDILLSHQTYAESEKFILSKYWETYYVEPGYTVLNLR
FT                   ILGSEYVPIAVEDNTDNLILPYTKPCMGTFVVRIKHVPQEVERIRKSFERTITLKQWRK
FT                   NVDESKAK"
     atggcctgcc tgaacgacta cgattacgat atactcttat cgcaccagac ctacgccgag        60
     tccgagaagt tcatcctctc gaaatactgg gagacctact acgtggagcc cggctatacc       120
     gtgctgaacc tccgcatact gggcagcgag tacgtgccca tcgccgtcga ggacaacacg       180
     gacaacctga tcctgcccta cacgaagccc tgcatgggca ccttcgtcgt gcgcatcaag       240
     cacgtacccc aggaagtaga gcgcatccgg aagagcttcg agaggacgat cacgctcaag       300
     cagtggcgta agaacgtcga cgagtctaaa gcaaaatag                              339
//

If you have problems or comments...

PBIL Back to PBIL home page