(data stored in ACNUC10043 zone)

EMBL: AP011532.PE552

AP011532.PE552       Location/Qualifiers
FT   CDS_pept        536190..536567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0552"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60624"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW02"
FT                   /protein_id="BAI60624.1"
FT                   /translation="MGIRQKVDFHSKPVIPGVFDLLIPPGTPRKLILKLAKEYPVQIVR
FT                   RDDIYVPVGVCDVERDLLAIRGDKKTIQKMEKILFQEIDAFINGQDARLHNYNKPVKLE
FT                   GISPVEKPVKPKAKVKAKAKK"
     atgggcatca ggcaaaaagt ggatttccac agcaagcccg tcatacccgg cgtcttcgac        60
     ctcctgatac cgcccggcac gccccggaag ctcatcctca agctggcaaa ggagtacccc       120
     gtgcagatcg tgcgccggga cgacatctac gtgcccgtag gcgtgtgcga cgtcgagcgg       180
     gacctactgg cgatccgcgg cgataagaag accatccaga agatggaaaa gatccttttt       240
     caggagatcg atgctttcat caacggccag gacgcccggc ttcacaacta caataagccc       300
     gtcaagctcg agggcatcag ccccgtggaa aagcccgtta aaccaaaagc aaaagtaaaa       360
     gctaaggcga aaaaataa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page