(data stored in ACNUC10043 zone)

EMBL: AP011532.PE557

AP011532.PE557       Location/Qualifiers
FT   CDS_pept        complement(539742..540086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0557"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60629"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW07"
FT                   /protein_id="BAI60629.1"
FT                   /translation="MSRELSEYDWDILKKLCPELNDGTCVSSGRMYRSILPPLSRHYAK
FT                   SREDFMERVEKLSDEELDYLICLAENGEESLTCIVPEHKDAFLEMVGRRTTKERAAKLR
FT                   KFIDFLETLG"
     atgtcgagag agctaagcga gtatgactgg gatatcctga aaaagctgtg ccccgagctg        60
     aacgatggta cctgtgtttc ctcgggccgc atgtaccggt ccattttgcc tcccctgtcc       120
     aggcactatg cgaagtccag ggaggacttc atggagcgcg tggagaagct gagcgatgag       180
     gagcttgatt atctcatctg ccttgcggag aatggggagg agagccttac ctgtatcgtg       240
     cccgagcata aggatgcgtt cctggagatg gtggggcgtc ggacgacgaa agagagagcg       300
     gctaagctgc ggaagttcat cgactttttg gagacgttag gataa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page