(data stored in ACNUC10043 zone)

EMBL: AP011532.PE560

AP011532.PE560       Location/Qualifiers
FT   CDS_pept        complement(541955..542650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60632"
FT                   /db_xref="GOA:D1YW10"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW10"
FT                   /protein_id="BAI60632.1"
FT                   /translation="MKVLVIDSSNGSMGVLLDPYLEGIRAAGAEVEVYNGRDLVVYPCC
FT                   GNLNCTVSTPGKCMPYDDMRWLRPKIGGGDALVLASPLYFDGVVGHETPSLRSIKARLV
FT                   PDMEPSVNHTYEHAVHTTREAVRLRKVVLVSGCGFWEIDGLNPVLTHIKAFCTNSYPGF
FT                   EGNLPGQRQAILRGGLKEGTSGDDIVKLANDAGRQLVGGCEKTMISAPLPSAVSRVKHE
FT                   WKSLILYQF"
     atgaaagtgc tcgtgatcga ctccagtaat ggaagcatgg gcgtactact cgacccgtac        60
     ctcgagggca tacgagcggc cggagcggaa gtggaagtgt ataatggccg tgacctggtc       120
     gtttatcctt gctgtggtaa cctcaactgc acggtcagca ctcctggaaa atgcatgcca       180
     tacgatgata tgcggtggct ccgcccgaag atcggcggtg gcgatgccct cgtcctggcg       240
     tcgccgctat atttcgacgg cgtcgtaggc catgaaacac catctctcag gtcgattaaa       300
     gcgagattag tgcccgatat ggagccttcg gtgaaccata cgtatgagca cgcagtccat       360
     acgacccggg aagctgtgcg attacgtaaa gtagtcctag tctcgggctg cggcttctgg       420
     gagatcgatg gcctgaatcc cgtacttacg cacatcaagg ctttctgcac gaactcatac       480
     ccgggcttcg agggaaattt gcccgggcaa agacaggcta tcctgagggg cgggctgaaa       540
     gagggcactt cgggcgatga catcgttaaa ctggcaaatg atgcggggcg gcagctcgtc       600
     ggtggatgcg aaaaaacgat gatctcggcg cctttgccat ccgccgtatc acgagtaaaa       660
     cacgaatgga agagcctgat actgtatcaa ttctaa                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page