(data stored in ACNUC10043 zone)

EMBL: AP011532.PE562

AP011532.PE562       Location/Qualifiers
FT   CDS_pept        complement(543538..544473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0562"
FT                   /product="ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0562"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60634"
FT                   /db_xref="GOA:D1YW12"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW12"
FT                   /protein_id="BAI60634.1"
FT                   /translation="MDDVVIGVSGLVKNYPNNPAVCNVSFKVRRGEIFALLGPNGAGKT
FT                   TIIKILEFVERPTSGFAYVLDSEQLYALTKDYTGIKEKIGALPQGFKGFDLLTVYENID
FT                   YFAQMYRKYGNVDRIIDEMGLRDKRNALFKHLSGGQKQRVGIAIALINDPEVVFLDEPT
FT                   TGLDPKARRDVWDMIKGLKARGKTVLLTTHYMDEAHQLADRICVLNRGSIVTHGTPEDL
FT                   INKYGGGNTLVVRGCSTGAIERLREALPGSLVSGNDVTVRLAYGDGMAAMAKAISVLGG
FT                   DGHLCQELYVKKPTLEDVFLNLTGERLDDA"
     atggacgatg tcgtgatagg ggtatccggg ctcgttaaga attacccgaa caatccggcg        60
     gtctgtaacg tttcgttcaa ggtgcgccgg ggagagatct tcgccttgtt aggccccaac       120
     ggcgccggaa agaccaccat catcaaaatc ctcgagttcg tcgagcgccc cacaagtggc       180
     tttgcctacg tcctggactc ggagcagcta tatgcattga cgaaggacta taccggtatc       240
     aaggagaaga tcggcgcgct tccacaggga tttaaagggt tcgacctttt gaccgtttac       300
     gagaacatcg actattttgc gcagatgtac cggaagtatg ggaatgtcga ccggatcatc       360
     gatgagatgg ggctgaggga taagcgtaac gcgttattca agcacctttc cggaggccag       420
     aagcagcgcg tgggcatcgc catcgcacta atcaacgacc cggaggtagt ctttttagac       480
     gagcccacga ccggcctcga cccgaaagcg cgacgggacg tttgggacat gataaaaggc       540
     ctgaaggcgc gaggcaagac cgtcctcctc acgacgcact acatggacga ggcacaccag       600
     cttgccgata ggatatgcgt cctgaacagg ggctctatcg ttacacatgg gacgcccgaa       660
     gacctgataa acaagtatgg cggcgggaac acgctggtcg tcaggggatg tagcacggga       720
     gccatcgaaa ggctaaggga ggcgctgccc ggaagcctcg tatcgggcaa cgatgtcacg       780
     gtgagactag cctatggcga cggcatggca gccatggcaa aggctatatc ggtactgggt       840
     ggcgatggcc atttgtgcca ggagctctac gtgaaaaagc ccacgctgga ggacgttttc       900
     ctgaacctga cgggagagcg cctggatgat gcataa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page