(data stored in ACNUC10043 zone)

EMBL: AP011532.PE563

AP011532.PE563       Location/Qualifiers
FT   CDS_pept        complement(544499..544978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0563"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0563"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60635"
FT                   /db_xref="InterPro:IPR019271"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW13"
FT                   /protein_id="BAI60635.1"
FT                   /translation="MRLKCRVGCPSYGTNLKCPPFVPTPDEFRQALKEYGFAMVLKHKP
FT                   PAMPETPGTAEERLAALRTQYREYYRTTLAIMLELEKVAFGRGYTFATAFVGGSCHLYE
FT                   KCNVEKGMCLSPAMARIAAEAVGVNVMKTAKNAGMAVKFPPEAKSPEPMALLLID"
     gtgcgcctca agtgccgggt cggctgcccg tcgtacggta caaacctgaa gtgccctccg        60
     ttcgtgccga cgcccgatga gttcaggcag gccctgaagg agtatggctt cgcaatggtc       120
     ctaaagcata agccgccggc aatgcccgaa accccgggta ccgccgaaga gcggctggct       180
     gcgttgcgga cacagtacag ggagtattac cggacgacct tggcgatcat gctggagctc       240
     gagaaagtcg cgttcggccg cggctatacc ttcgccacgg cctttgtcgg cggctcctgc       300
     cacctgtacg aaaaatgcaa cgtcgaaaag ggcatgtgcc tgagcccggc gatggcccgt       360
     atcgcggccg aagcggtcgg cgtcaacgtg atgaagacgg cgaaaaacgc cggcatggca       420
     gtgaaatttc cgccggaggc taaatcgccc gagccaatgg cgttattact catcgattag       480
//

If you have problems or comments...

PBIL Back to PBIL home page