(data stored in ACNUC10043 zone)

EMBL: AP011532.PE564

AP011532.PE564       Location/Qualifiers
FT   CDS_pept        complement(545079..545825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0564"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60636"
FT                   /db_xref="GOA:D1YW14"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW14"
FT                   /protein_id="BAI60636.1"
FT                   /translation="MSRITTDIKYSLLQFFRNRQSVLVTFLFPVVFLVMAWYLFGSRAD
FT                   YVMGNSALYADFLLPGIVGIAIMVSAVDHTVGFVSRLRAAGIFRKLAMTPIRRIEWNVS
FT                   RVLTGTVVVLLSVAVSLAVAWLAFGVTPGLNLIVALLVLAGGVMFIGMGMVIAYIIKGD
FT                   EAANAAFTVTLPLIFLSGSIFPVGRLPWFLQAVAAISPLTYLNDGLRSAMVTGNMSSAV
FT                   ADLAVVSALALIFFSIGVIALRWREG"
     atgtctcgaa taacgaccga tataaagtac agcctgctcc agttcttccg gaaccggcag        60
     tcggtgctcg tcaccttcct cttcccggtg gtcttcctcg tcatggcgtg gtacctgttc       120
     gggagccggg cggactacgt gatgggcaat agcgccttgt acgcggattt cctgctaccc       180
     ggcatcgtcg ggatcgccat catggtatcg gccgtcgacc atacggtggg ctttgtcagc       240
     aggctccggg ccgccggcat cttccgcaag ctggcgatga cgcccatcag gcggatcgaa       300
     tggaatgttt cccgggtctt gacggggacg gtagtcgtgc tgctgtccgt cgccgtatcg       360
     ctcgccgtgg cctggctggc gttcggcgtc accccgggcc tgaacctcat cgtggcacta       420
     ctggtactgg ccggcggggt catgttcatc ggcatgggca tggtcatcgc ctatattatt       480
     aagggcgacg aagcggccaa cgccgcgttc accgttacgc tgccgctcat cttcctgtcg       540
     ggctccatct tcccggtggg acggctgcca tggttcctgc aggccgttgc ggcgatttcc       600
     ccgctaacct acctgaacga cggcctgagg agcgccatgg tcacgggcaa catgagcagc       660
     gccgtggcgg acctggccgt cgtgagcgcg ctagccttaa tatttttcag tatcggcgtc       720
     atagctctcc ggtggaggga gggttaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page