(data stored in ACNUC10043 zone)

EMBL: AP011532.PE567

AP011532.PE567       Location/Qualifiers
FT   CDS_pept        complement(548319..550010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0567"
FT                   /product="ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0567"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60639"
FT                   /db_xref="GOA:D1YW17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW17"
FT                   /protein_id="BAI60639.1"
FT                   /translation="MSVDNEKYWNIISAKYDSIVDRTIGDRLRPQVRERLEREKGLGRV
FT                   AEFGCGTGYFTRTLAEVADSVVATDLSDEMLARAREGMKGIINVTIQKEDCMRTSFADR
FT                   AFDAAFMALVINVTDNPMQALCEANRILKPGGVIIIANPDGSYIDVADMPGTMIRFSSN
FT                   YGFAADYFTKEEFEAMEKSARGISDNDLRQMLPAAGFQITSLEILGDDTSASNLAMDYV
FT                   RAVKTSDRAASSAGMLKNYERAEAVIVVKDLSKYYGKFIAVFGVSFTVRKGEVFALLGP
FT                   NGAGKTTIVEVLELLKSPTRGFISILGSDVLIGAPVGNLFMAQDRNFADLKEKIGVLPQ
FT                   GFNSFELLTVYENIDYFARMYSKHVDADRLIDELGLREKRNALFKDLSGGLKQRVGIAI
FT                   ALINDPDIVFLDEPTTGLDPRSRRDVWEAIKRLKAKGKTIFLTTHYMDEAYQLADRVCV
FT                   IHKGSIVAEGSPEDLINRYGGGNTLVIRECSPDALEPLAKAIPGSTIDGNNVMAKLQED
FT                   DGMASIAKAVEVIKSGGFACREIYVKKPTLEDVFLNLTGEKLIEGG"
     atgtctgtgg acaatgaaaa gtactggaat atcatatcag caaaatacga ttccatcgtc        60
     gacaggacga tcggcgatag gctcaggccc caggtgcggg aaaggctgga gcgtgagaag       120
     ggcctgggcc gggtcgcgga gttcggctgc ggtacgggat attttacgag gacccttgcg       180
     gaggtggccg acagcgtcgt cgccacggac ctcagcgacg agatgctggc ccgggcacgg       240
     gaggggatga agggcattat aaacgtgacc atccaaaagg aggactgcat gaggacatcg       300
     ttcgccgata gggcgttcga cgccgcgttc atggcgctcg ttatcaacgt cacggataat       360
     ccgatgcagg ccctgtgcga ggcgaaccgg atattgaagc cgggcggcgt gatcatcatc       420
     gcaaacccgg atggaagcta catcgacgtc gcagacatgc ccgggacgat gatacggttc       480
     tcctccaatt acgggttcgc cgccgattat tttactaagg aagagttcga ggccatggag       540
     aaaagcgcca ggggcatatc ggataacgac ctgcgccaga tgctccccgc ggccggcttc       600
     cagatcacgt ccctggagat cctcggggac gacacgagtg cctcgaatct cgccatggac       660
     tacgtccggg ccgtcaagac ttcggatcgt gcggcatcgt cggccgggat gctcaagaac       720
     tatgaaagag cggaggccgt gatcgtagta aaggacctca gtaagtacta tggtaaattc       780
     atcgccgtct tcggcgtctc gttcacggtc cggaagggcg aggtcttcgc cctgctcggc       840
     cccaacggcg ccggcaagac caccatcgtg gaggtcctcg agctgctcaa atccccgacg       900
     cgcggcttta ttagcatcct gggaagcgat gtgctcatcg gggccccggt gggcaatcta       960
     ttcatggccc aggacaggaa ttttgcggac ttaaaggaaa agatcggagt acttccgcag      1020
     ggctttaact cgttcgagct gctcacggtc tacgagaaca tcgactactt cgcccggatg      1080
     tactcgaagc acgtggacgc cgaccggctc atcgatgagt tagggctgag ggagaagcgg      1140
     aacgccctgt tcaaggacct ctccggcggc ctgaagcagc gggtgggcat cgccatcgcg      1200
     ctcatcaacg accctgatat cgtcttcctc gacgagccga cgaccggcct ggacccccgg      1260
     tccaggaggg acgtgtggga ggccatcaag aggctcaagg cgaagggtaa gaccatcttt      1320
     ttgactaccc attacatgga cgaggcatac cagctcgccg accgggtctg tgtcatccac      1380
     aagggcagca tcgtcgccga gggctcgccc gaggacctca tcaaccggta tggcggaggc      1440
     aacaccctgg tcatcagaga atgcagcccc gacgccctgg agccgctggc gaaggccata      1500
     cccgggagca cgatcgacgg caataacgta atggcaaagc tgcaggagga cgatggcatg      1560
     gcaagcatcg cgaaggccgt cgaggtcatc aagtccggcg gcttcgcctg ccgggagatc      1620
     tacgtgaaga agccaacgct cgaggacgtg ttcctgaacc tgaccggcga aaagctgatc      1680
     gaaggaggat aa                                                          1692
//

If you have problems or comments...

PBIL Back to PBIL home page