(data stored in ACNUC10043 zone)

EMBL: AP011532.PE572

AP011532.PE572       Location/Qualifiers
FT   CDS_pept        553928..555373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0572"
FT                   /product="hypothetical protein"
FT                   /note="Contains at least one PT repeat (IPR006970)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0572"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60644"
FT                   /db_xref="InterPro:IPR006970"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW22"
FT                   /protein_id="BAI60644.1"
FT                   /translation="MVFSVIRKPLALLLVVVMVGAIMLMAVNGAIGQQGPGPVDYGGGY
FT                   AVPGAPGISLGPGTNTVAMSVSIASQQDSQIYFQVNSFAVRDQQTQTFTVYDLSSAMPG
FT                   IMDTGNNRVQIDIGKLQSSIQSTSQAAMDDLYSILRPSVNSLMVVADISQQGQQGSRAT
FT                   FQVERLTVIMPDGQTSEFDLSQPMSIVVDGAALRIFAVGFEQMYSLVNTYIVNIQNNYY
FT                   TEINYNIVTGPVIVVTPPAVYPVLTPIRFPAAWPVFYPVPVPVPIPVVSVRPHPPSVTP
FT                   TKQPTMGPTVSPTKGPTISPTARPTGMPTVSPRISPTIGPTKRPITSPRASLIATRRPV
FT                   ISPGATISPSLIPTRRPVGTFSPSLIATKKAAPSLIATKKATPTFQATKAPGGIATKRP
FT                   ISATYRPTTGPVTRPTIKATQAPVGGGAKRPIATMPVTPRKPTAGDERIRRSLQPPLST
FT                   IVPGTAASPSPSPTATIRPTKVI"
     ttggtatttt cggtcattag aaagcccctg gcattgctgt tagtggtggt gatggtgggc        60
     gccattatgc tcatggcggt caacggcgcc atcggacagc aggggccggg gcccgtggat       120
     tacggcggag gatacgccgt cccgggagcc cccggcatca gcctggggcc aggtacgaac       180
     acggtcgcta tgtccgtcag catagcgtcg cagcaggaca gccagatata tttccaggtg       240
     aacagctttg cggtgaggga ccagcagaca cagactttca ccgtatacga cctgagcagc       300
     gccatgccgg gcatcatgga cacgggtaat aaccgggtac agatcgacat cggtaagctg       360
     cagtcgtcca tacagtcgac gagccaggcg gccatggatg acctctacag cattctgagg       420
     ccttccgtca actcgctgat ggtggtcgcc gacatatcgc agcagggcca gcagggctcc       480
     agagcgacgt tccaggtgga gaggctcacg gtcatcatgc ccgacggcca gacgagcgag       540
     ttcgacctga gccagcccat gtccatcgtc gtggacggcg ctgccctcag gatattcgcc       600
     gtcggattcg agcagatgta ctccctggtg aacacgtaca tcgtgaacat ccagaataac       660
     tattacacgg agatcaacta taacatcgtg acaggcccgg tcatcgtcgt cacgccgccg       720
     gccgtttacc cggtgctgac gcctatccgt ttcccggccg cgtggcccgt cttttacccg       780
     gtgcccgtcc cggtgccgat acccgtggtg tccgtgcggc cgcatccgcc ttcggtgacg       840
     cccacgaagc agccgacaat gggccccacg gtgagcccga ctaagggccc gaccataagc       900
     cctacggcca ggcctacagg catgccgacg gtgtcgccga ggatctcgcc gaccatcggg       960
     ccgacgaagc ggcccatcac gtcgcccagg gcatcgctga tagcgacgag gaggccggtc      1020
     atatcgccag gtgcgaccat atctccgtct ctcatcccga cgaggaggcc ggtcggcacg      1080
     ttctcgccgt ccttgatcgc gacgaagaaa gcagcgccct ctttgatagc gacaaagaag      1140
     gccacgccga ctttccaggc gacgaaagct ccgggaggca tagcgacgaa gcggcccata      1200
     tcggccacat accgtcctac gacggggccc gttaccaggc ccacgataaa ggcgacacag      1260
     gcgccagtag gcggaggggc taagcgcccc atcgccacta tgcctgtgac gccgagaaag      1320
     cctacggcgg gagacgagag gatccggcgc agcctgcagc cgcctctgtc cacgatcgta      1380
     cccggcacgg cggcttctcc ctcgcccagc ccgacggcga ccataaggcc gacgaaggtc      1440
     atttaa                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page