(data stored in ACNUC10043 zone)

EMBL: AP011532.PE574

AP011532.PE574       Location/Qualifiers
FT   CDS_pept        555874..557706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one PilT protein, N-terminal domain
FT                   (IPR002716).; Contains one Nucleotide binding protein, PINc
FT                   domain (IPR006596).; Contains one Bacterial type II
FT                   secretion system protein E domain (IPR001482).; Contains
FT                   one KH, type 1 domain (IPR004088)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0574"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60646"
FT                   /db_xref="GOA:D1YW24"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW24"
FT                   /protein_id="BAI60646.1"
FT                   /translation="MKLVPDTSVIIDGRITRKVESGEFEHALIIVPEAVISELETQANQ
FT                   GKEIGFNGLEELRKLQTMAREGRISIEFSGSRPTLNQIRMAPGGEIDDMIRNIAVENDA
FT                   ALVTSDKVQAGVARAKGINIIYLKPDIDELGHFDLMDYFTEDTMSVHLKADVVPMAKRG
FT                   TIGDMRLVKAGKETLSDKQLLHMAHEILERAKQDPNAFTEIEMNGATVVQLGNLRIAIA
FT                   TPPFSDGVEITAVRPVARLSIEDYKYSGTFKDRIIEKRRGILISGPPGAGKSTFAQACA
FT                   DFLFEHDFIVKTMESPRDLQLPEAITQYAPLNGSMENTADILLLVRPDYTIYDELRKTS
FT                   DFEIFSDMRLSGVGMIGVVHATRAIDAIQRFIGRVELGVIPQVVDTVVFIDHGSIEKVY
FT                   DIEFTVKVPAGMTESDLARPVINVKELESGRAEYEVYTFGEQVVVMPVGAEKPQKASRK
FT                   ADEKVVMKEVARFARGPVEVEMVGDNKAIVRVREKDIPAILGRGGKTIGQIERASGAHI
FT                   DVRTLEEGRVEAAAPEEQGMTLPVGVQEVKKHVILDVGKKFAGQTVEILTGGDYIFTAT
FT                   VGRTGIIKIPRGSSFIDRILKAQMHGEEVRARLV"
     atgaaactag tccccgacac gagcgtcatc atcgacggcc ggatcaccag aaaagtggag        60
     tccggcgagt tcgagcatgc attaataatc gtacctgagg ccgtcatctc cgagctggag       120
     acgcaggcga accagggcaa ggagataggc ttcaacggcc ttgaagagct gagaaagctg       180
     cagaccatgg cccgggaggg gaggatcagc atcgagttct cgggcagccg gcccacgctg       240
     aaccagatcc ggatggcccc gggcggcgag atcgacgaca tgatccggaa catcgccgtg       300
     gagaacgacg cggccctggt cacgagcgac aaggtgcagg cgggcgtggc ccgcgcgaag       360
     ggcatcaaca tcatttacct gaagcccgac atcgatgagc tcgggcattt cgacctgatg       420
     gattatttca cggaagacac catgtccgtc cacctgaagg ccgacgtggt gcccatggcc       480
     aagcgcggca ccatcggcga catgcggctc gtcaaggcgg gcaaggaaac gctatccgac       540
     aagcagcttc tgcacatggc ccacgagatc ctggagcggg ccaagcagga cccgaacgcc       600
     ttcaccgaga tcgagatgaa cggggccacc gtggtacaat taggcaacct gcgtatcgcc       660
     atcgccacgc ctccattctc tgacggcgtg gagatcactg ccgtcaggcc cgtggcccgc       720
     ctcagcatcg aggattacaa gtacagcggc accttcaagg accgcatcat cgagaagcgc       780
     cggggcattc tcatctcggg ccctcccgga gcgggtaagt ccacgttcgc gcaggcctgc       840
     gccgactttt tgttcgagca cgacttcatc gtgaagacca tggagtcgcc tcgtgacctt       900
     cagctgcccg aggcgatcac gcagtacgcg cctcttaacg gcagcatgga gaatacggcc       960
     gacatcctgc ttttggtgag gcccgactat acgatatacg acgagctgcg caagacgtct      1020
     gatttcgaga tattctcgga tatgcgcctt tcgggcgtgg gcatgatcgg cgtggtccac      1080
     gctaccaggg ccatcgatgc cattcagcgg ttcatcgggc gcgtcgaatt aggcgtcatt      1140
     ccccaggtcg tggacacggt cgtcttcatc gaccacggct ctatcgagaa agtctacgat      1200
     atcgagttca cggtcaaggt gcccgccggc atgaccgagt ccgacctcgc caggccggtc      1260
     attaacgtaa aagagctcga atctggcagg gcggaatatg aagtgtacac cttcggcgag      1320
     caggtggtgg tcatgcccgt aggggcggaa aaaccacaaa aggcctcgcg gaaggccgac      1380
     gaaaaggtcg tcatgaaaga ggtcgccagg ttcgcgaggg gccccgtgga ggtcgaaatg      1440
     gtcggggaca acaaggcgat cgtaagggta agggaaaagg acattcccgc cattctggga      1500
     aggggcggta agaccatcgg ccagatcgag cgggcgtccg gcgcgcacat cgacgtccgg      1560
     actctcgaag agggccgtgt ggaggcggcc gctcccgaag agcaggggat gaccctgccc      1620
     gtgggcgtgc aggaggtcaa aaagcacgtc atcctggacg tgggcaagaa gttcgccggg      1680
     cagacggtcg agatcctcac cgggggcgat tatattttta ctgcgaccgt cgggcgcacg      1740
     ggcattatca agatccccag gggatccagc ttcatcgacc gtatcctgaa ggcgcagatg      1800
     cacggcgaag aggtgcgcgc aaggctcgtt taa                                   1833
//

If you have problems or comments...

PBIL Back to PBIL home page